KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1647Help
Entry
BURPS1106A_1647   CDS       T00480                                 

Definition
(GenBank) alcohol dehydrogenase, short-chain family
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00061  Fatty acid biosynthesis
bpl00650  Butanoate metabolism
bpl01100  Metabolic pathways
bpl01120  Microbial metabolism in diverse environments
bpl01200  Carbon metabolism
bpl01212  Fatty acid metabolism
Module
bpl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BURPS1106A_1647
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BURPS1106A_1647
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bpl01004]
    BURPS1106A_1647
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BURPS1106A_1647
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     BURPS1106A_1647
Lipid biosynthesis proteins [BR:bpl01004]
 Fatty acid synthase
  Component type
   BURPS1106A_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: ABN91177
UniProt: A3NU97
Structure
PDB: 

Position
I:complement(1598058..1599251)
Genome map
AA seq 397 aa AA seqDB search
MIIKPRVRGFICVTTHPAGCAASVREQIAYVARRGPIERGPKKVLVIGASTGYGLAARIA
AAFGAGAATLGVFFERAPADAKPGTAGWYNSAAFHDEAAARGLQATSVNGDAFSDEIKHK
TIDAIRRDLGQVDLVVYSVAAPRRTHPKTGVTHQSTLKPIGHAVRLRGIDTDNEAIKETL
LQPATPDEIADTVAVMGGEDWRMWIDALDAAGVLADGAKTTAFTYLGEQVTHDIYWNGSI
GEAKKDLDRTVLALRGKLAARGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKARGT
HEGCIEQVDGLLRDSLYGAQPHVDAEGRLRADRLELDPAVQARVLELWDQVTDDNLYPLT
DFAGYKAEFLRLFGFGIDGVDYDAPVEPNVRIPNLIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaaccgcgcgtacgcggcttcatctgcgtcaccacccaccccgccggctgc
gcggcgagcgttcgcgagcagatcgcgtacgtcgcccgccgcggcccgatcgagcgcggc
ccgaagaaggtgctcgtgatcggcgcgtcgacgggctacgggctcgccgcgcgcatcgcc
gccgcgttcggcgcgggcgcggcgacgctcggggtgttcttcgagcgcgcgccggcggac
gcgaagcccggcacggccggctggtacaacagcgcggcgttccacgacgaagcggccgcg
cgcggcctccaggcgacgagcgtcaacggcgacgcgttctccgacgagatcaagcacaag
acgatcgatgcgatccggcgcgatctcgggcaggtggaccttgtcgtctacagcgtcgcc
gcgccgcgcaggacgcatccgaaaacgggcgtcacgcatcagtcgacgttgaagccgatc
ggccacgcggtgcggctgcgcggcatcgatacggacaacgaggcgatcaaggaaacgctg
ctgcagccggccacgcccgacgagatcgcggacacggtcgccgtgatgggcggcgaggac
tggcgcatgtggatcgacgcgctcgatgcggcgggagtgcttgccgacggcgcgaagacg
accgcgttcacgtatctgggcgagcaggtcacgcacgacatctactggaacggctcgatc
ggcgaagcgaagaaggatctcgaccgcaccgtgctcgcgctgcgcggcaagctcgccgcg
cgcggcggcgacgcgcgcgtctcggtgctgaaggcggtcgtcacgcaggcgagctccgcg
atcccgatgatgccgctctacctgtcgctgctcttcaaggtgatgaaggcgcgcggcacg
catgaaggctgcatcgagcaggtcgacggcctgttgcgcgacagcctgtacggcgcgcag
ccgcacgtcgacgccgaaggccggctgcgcgcggaccgcctcgagctcgatccggccgtg
caggcgcgcgtgctcgagctgtgggaccaggtgacggacgacaatctgtatccgctcacc
gatttcgccggctacaaggccgaattcctgcgcctgttcggcttcgggatcgacggcgtc
gattacgatgcgcctgtcgagccgaacgtacggattccgaatctgatcgaatga

DBGET integrated database retrieval system