KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1652Help
Entry
BURPS1106A_1652   CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 17kDa_Anti_2 DUF732 DUF5061
Motif
Other DBs
NCBI-ProteinID: ABN88937
UniProt: A3NUA2
Position
I:1606074..1606460
Genome map
AA seq 128 aa AA seqDB search
MTTRARVSILPRVLVGAACAAAALGAHAQNNLNFLNDTPISYFSKADTASLAKAVQKVRD
EGKDGETVDWVNDGRGTKLAAKLTPSTTEQEGRTCREIKTEIEAKGQSMTLRPLYCKTAA
GKWQLQKR
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgagcccgtgtctcgatcctcccgcgcgtgctggtgggcgccgcatgtgcg
gccgccgcgcttggcgcgcacgcgcagaacaacctgaacttcctgaacgacacgccgatc
agctatttcagcaaggcggacaccgcatcgcttgcgaaggccgtgcagaaggtgcgcgac
gagggcaaggacggcgagaccgtcgactgggtcaacgacggccgcggcacgaagctcgcg
gcgaagctcacgccgagcacgaccgagcaggaaggccgcacgtgccgcgagatcaagacc
gagatcgaggcgaaggggcaatcgatgacgctgcggccgctctattgcaagaccgcggcg
ggcaagtggcaactgcagaagcgctga

DBGET integrated database retrieval system