KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1656Help
Entry
BURPS1106A_1656   CDS       T00480                                 

Definition
(GenBank) hypothetical protein
  KO
K04062  osmotically inducible lipoprotein OsmB
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    BURPS1106A_1656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly-zipper_YMGG Rick_17kDa_Anti Gly-zipper_Omp Bacteriocin_IIc TraT
Motif
Other DBs
NCBI-ProteinID: ABN89828
UniProt: A3NUA6
Position
I:1609264..1609503
Genome map
AA seq 79 aa AA seqDB search
MRGNALEDSIMMKKTHFLVRATVIAVVLASLGACAMNRTQRNAGIGAAAGGALGYLITGG
PIGTVAGAAAGGLVGAGVR
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcaacgctctcgaagacagcatcatgatgaagaagacccattttctcgttcgc
gccaccgtcatcgccgtcgtgctcgccagcctcggcgcgtgcgcgatgaaccgcacgcaa
cgcaacgccggcatcggcgcggcggcgggcggcgcgctcggctacctgatcacgggcggg
ccgatcggcacggtcgcgggcgcggcggcgggcggcctcgtcggcgccggcgtgcgctga

DBGET integrated database retrieval system