KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1658Help
Entry
BURPS1106A_1658   CDS       T00480                                 

Definition
(GenBank) CAIB/BAIF family protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_transf_3
Motif
Other DBs
NCBI-ProteinID: ABN92263
UniProt: A3NUA8
Position
I:complement(1609832..1611052)
Genome map
AA seq 406 aa AA seqDB search
MGALSHIRVLDLSRVLAGPWCAQTLADLGADVIKVERPECGDDTRHWGPPYLKTPDGADT
REAAYYLAANRNKRSVTVDIATPEGQRIIRELAAQCDVVLENYKVGQLAKYGLDYASLAA
VKPGLVYCSVTGFGQTGPYAHRAGYDFIIQGMGGFMSITGERDGLPGGGPQKAGVAIADL
ATGLYSTIAILAALAHRDRTGEGQHIDMALLDVQVALLANMNTNFLASGKPPVRWGNAHP
NIVPYQTFETSDGWIIVAVGNDGQFRKFVEAGGRPELADDERFATNPARVRHRDTLVPIV
AAMTKTRTKREWLDALEALGVPCGPINDLAEVFDDEQVRARGMQVDLPHPSGASAKLVRN
PIRMSATPPDARSAPPLLGEHTDAVLRDLLGYGDAAIAALRDKRVV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgggagccctcagccacatccgcgtcctggacctgagccgcgtgctcgcgggcccgtgg
tgcgcgcagacgcttgccgatctcggcgccgacgtgatcaaggtcgagcgcccggagtgc
ggcgacgacacccggcactggggcccgccgtacctgaagacgccggacggcgccgacacc
cgcgaagccgcgtactacctcgccgcgaaccgcaacaagcgctcggtgacggtcgatatc
gcgacgcccgagggccagcggatcatccgcgagctcgccgcgcaatgcgacgtcgtgctc
gagaactacaaggtcggccagctcgcgaaatacgggctcgactacgcgtcgctcgcggcc
gtgaagcccggcctcgtctattgctcggtgacgggcttcggccagacgggcccgtacgcg
caccgcgccggctacgacttcatcatccaggggatgggcggcttcatgagcatcaccggc
gagcgcgacggcctgccgggcggcggcccgcagaaggcgggcgtcgcgatcgccgatctc
gcgacgggcctgtactcgacgatcgcgatcctcgccgcgctcgcgcaccgcgaccgcacg
ggcgaaggccagcacatcgacatggcgctcctcgacgtgcaggtggcgctcctcgcgaac
atgaacacgaacttcctcgcgagcggcaagccgcccgtgcgctggggcaacgcacatccg
aacatcgtgccgtaccagacgttcgagacgagcgacggctggatcatcgtcgcggtcggc
aacgacggccagttccgcaagttcgtcgaggcgggcgggcgccccgagctcgccgacgac
gagcgcttcgcgacgaaccccgcgcgcgtgcgccaccgcgacacgctcgtgccgatcgtc
gccgcgatgacgaagacgcgcacgaagcgcgagtggctcgacgcgctcgaggcgctcggc
gtgccgtgcggaccgatcaacgacctcgccgaagtgttcgacgacgagcaggtgcgcgcg
cgcggcatgcaggtcgatttgccgcatccgagcggcgcgagcgcgaagctcgtgcgcaat
ccgatccggatgagcgcgacgccgcccgacgcgcgcagcgcgccgccgctgctcggcgag
cacacggacgcggtgctgcgcgacctgctgggttacggcgacgcggcgatcgccgcgctc
agggacaagcgcgtcgtctga

DBGET integrated database retrieval system