KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1661Help
Entry
BURPS1106A_1661   CDS       T00480                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: ABN91193
UniProt: A3NUB1
Position
I:complement(1614760..1615785)
Genome map
AA seq 341 aa AA seqDB search
MTDHSRKMNNSDSIHPTERIMDLAALAIFRAVVRENGVTRAAAKLNRVQSNVTTRIKQLE
EQLGAPLFVRDGRRLVLTPAGETLLPYAERLLALADEARHAVTENRPHGRLRLGAMESTA
ASRLPALLARYHQAWPDVTLELVTGTTGKLIGLVRDFELDAALVATPAGSEALGEPFETA
SAFTEELVLLTPRGHPRVRTPRDVRLPTLVAFERGCAYRGCVERWYAAEGLKPERVLELG
SYHAIVACVAAGAGVAVAPRSVLAVQREPDSLGVHPIDGMPPIDTMLVWRQGHFSAALAA
LRDALRDAAAAANATDVAAHEAAKVAPRRTRRGAARETLPA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgatcattctcgaaaaatgaataattcagattcgatccatcccacggagagaatc
atggatctggcggctctcgcgatctttcgcgcggtcgtgcgcgagaacggcgtgacgcgc
gcggcggcaaagctcaaccgtgtgcaatcgaacgtcacgacgcgcatcaagcaactggag
gagcagctcggcgcgccgcttttcgtgcgcgacggccgccggctcgtgctcaccccggcc
ggcgagacgctgctgccgtatgcggagcgtctgctcgcgctcgccgacgaggcgcgccac
gcggtcaccgaaaaccggccgcacggccggttgcggctcggcgcgatggaaagcaccgcg
gcgagccgcctgcccgccttgctcgcccgctaccaccaggcgtggcccgacgtcacgctc
gagctcgtcaccggcacgacgggcaagctgatcggtctcgtgcgcgacttcgagctcgac
gccgcgctcgtcgcgacgccggccggctccgaggcgctcggcgagccgttcgagacggcg
tccgcgttcaccgaagaactggtgctgctcacgccgcgcggccatccgcgcgtgcgcacg
ccgcgcgacgtgcggctgccgacgctcgtcgcgttcgagcgcggctgcgcgtaccgcggc
tgcgtcgagcgctggtacgcggcggaggggctgaagcccgagcgcgtgctcgaactcggc
tcgtatcacgcgatcgtcgcgtgcgtcgcggcgggcgcgggcgtcgcggtcgcgccgcgc
tcggtgctcgccgtccagcgcgagccggacagcctcggcgtgcacccgatcgacggcatg
ccgccgatcgatacgatgctcgtctggcgccaggggcatttctcggcggcgctcgccgcg
ctgcgcgacgcgttgcgcgacgccgccgccgcggcgaacgccaccgacgtcgcggcgcac
gaagcggcgaaggtcgcgccccggcgcacgcggcgcggcgccgcgcgcgaaacgctgccg
gcttga

DBGET integrated database retrieval system