KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1662Help
Entry
BURPS1106A_1662   CDS       T00480                                 

Definition
(GenBank) major facilitator family transporter
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_4 MFS_1 Pex14_N
Motif
Other DBs
NCBI-ProteinID: ABN92341
UniProt: A3NUB2
Position
I:1615872..1617512
Genome map
AA seq 546 aa AA seqDB search
MNSLPSFLAAASGRRGPSHDQRAACRAALAGAVALAVALGVGRFAFTPLLPLMLAGGELD
IRHGGWLASANYAGYFVGAMTCARIAVDPARMVRAGLAATVLLTFAMGLASPFWVWALVR
FVGGAVSAWTFVFASQWGLRRVVEHGAPAWGGVIYTGPGIGIVATGLIGFALAGRHAALG
WIGFAAASAVLTAFVWRAFGAAGAGTDGGQSRGGAKRAGDGVGVADAAGRAGERLAAGAT
GAAEGAEGAEAVADAVSAANVADTADTANSANSANSANSANSANSANSANSANSANSANS
ANSANSANSANSANSANSATATAERNSPVAGVAGQHGAMAAPAARAPHVESAAARRDAFW
LVLLYGLPGFGYIITATFLPVIARAALPAHSRWPDLFWPMFGAALIAGALLGARLPSGWD
NRLLLAACCAVQALGVALGIVWPTAPGFALGSALVGLPFTAITLFAMREARRLRGERAAG
LMGYATASYGVGQIAGPLAAAPLAAHAGSFSPALWLAATMLVVGAAGFAAVALRAWRART
RGGGVG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaactctctaccttctttcctcgccgcggctagtgggcggcgcggtccgtcgcacgat
caacgcgccgcgtgccgcgcggcgcttgcgggcgcggtggcgctcgcggtggcgctcggc
gtcgggcgctttgccttcacgccgctgctgccgctgatgctcgcgggcggcgagctcgac
atccggcacggcggctggctcgcgtccgcgaattacgcgggctatttcgtcggcgcgatg
acttgcgcgcgcatcgccgtcgatccggcgcggatggtgcgcgccggcttggcggcgacg
gtcttgctgacgtttgcgatgggactcgcgagcccgttctgggtatgggcgctcgtgcgc
ttcgtcggcggcgcggtgagcgcatggacgttcgtgttcgcgtcgcagtggggcctgcgg
cgcgtcgtcgagcacggcgcgcccgcatggggcggcgtcatctacacggggccggggatc
gggatcgtcgcgaccgggctgatcggcttcgcgctcgcggggcgtcacgcggcgctcggg
tggatcgggttcgccgcggcgtcggcggtgctgacggcgttcgtgtggcgcgcattcggg
gccgcgggcgccggcacggacggcgggcaatcgcgcggcggcgcgaagcgagcgggcgat
ggcgtcggcgttgcggatgccgctggtcgggccggcgagcggctagcggccggagcgacc
ggagcggcagaaggggcagaaggggcagaagcggtggccgacgcggtcagcgcggctaat
gtggccgacacggccgacacggccaactcagccaactcagccaactcagccaactcagcc
aactcagccaactcagccaactcagccaactcagccaactcagccaactcagccaactca
gccaactcagccaactcagccaactcagccaactcagccaactcagccaactcagcgacc
gcgacagccgaaagaaattccccggtggcgggcgtcgccggccagcacggcgcgatggcc
gcgcccgccgcgcgtgcgccgcacgtcgagtcggccgccgcccgccgcgacgcattctgg
ctcgtgctcctctacggcttgcccggcttcggctacatcatcaccgcgaccttcctgccg
gtgatcgcccgcgccgcgctgcccgcgcattcgcgatggcccgatctgttctggccgatg
ttcggcgcggcgctgatcgccggggcgctgctcggcgcgcggctaccgagcggctgggac
aaccggctgctgctcgccgcgtgctgcgcggtgcaggcgctcggtgtcgcgctcggcatc
gtctggccgacggcgcccgggttcgcgctcggcagcgcgctcgtcggcttgccgttcacc
gcgatcaccttgttcgcgatgcgcgaggcgcgccgcctgcgcggcgagcgggcggcgggc
ctgatgggctatgcgaccgcttcatacggtgtcggtcagatcgccgggccgctcgccgcc
gccccgctcgccgcgcacgcggggtcgttctcgccggcgctgtggcttgcggcgacgatg
ctggtggtgggggcggccggattcgcggccgttgcgctgcgcgcatggcgcgcgaggacg
cgcggcggcggagtcgggtaa

DBGET integrated database retrieval system