KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1664Help
Entry
BURPS1106A_1664   CDS       T00480                                 

Definition
(GenBank) PDZ domain protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 PDZ_2 PDZ Tricorn_PDZ Trypsin Peptidase_S46
Motif
Other DBs
NCBI-ProteinID: ABN92389
UniProt: A3NUB3
Position
I:1617844..1619400
Genome map
AA seq 518 aa AA seqDB search
MSHQTLGRALIHVAALGAVLVGFACLQPTPLAAGTLQSPAKAKRIAQIGAAGPVDFPTLV
ERYGPAVVSVSVPAQDPQMSASGLEALDPDDPFFAYFKSAATQPALSPENGPRAMAGAGS
GFIVGADGIILTTAYVVGQASEATVRLIDRREFKARVLAVDDSSDVAVLQIDATKLPTVR
LGDSSRVRTGEPVLTIGTPDGSANTVTTGIVSATARMLPDGGRFPFFQTDVTGNLDNSGG
PVFNRAGEVIGIDVQIYGSGERNPGVTFAIPIDMAMKVRAQVLQAQRQARQQAQPPMQQA
QQAQQAPPAAAQNALGVDAQDVGPGLAAAFGLPRPAGALVNAVEPGSPAAAVGLKPGDVI
VQIGDRPLGRSAELAGDLAALPPGASAPITLIRNRMPMTVMLGSGAAASAPTGATASPGN
AAAGRSETGGADRLGLTMHPLTDDERRSTGLPVGMVVDAVRGPAANAGIRPGDVVLELDD
TLIETPDMVPALEAKAGKVVAVLIQRGSERRFVSVKAR
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcatcaaacgcttggccgcgccctgattcacgttgcagcgctcggggcggtgctt
gtcggcttcgcttgcctgcagccgacgccactcgccgcgggtacgctgcaatcgccggcg
aaggcgaagcgaatcgcgcagatcggcgccgcggggccggtcgattttcccacgctcgtc
gagcgatacgggcccgccgtcgtcagcgtgagcgtgcctgcgcaggatccgcagatgtcg
gcgtccggcctcgaggcgctcgatcccgacgatccgttcttcgcctacttcaaatccgcc
gccacgcagcccgcgctgtcgccggagaacgggccgcgcgcgatggcgggcgccggatcc
ggttttatcgtcggcgccgacgggatcatcctgacgaccgcgtacgtggtcgggcaggcg
agcgaggcgacggttcgcctgatcgaccggcgcgaattcaaggcgcgggtgctggccgtc
gatgattcgagcgatgtggccgtgttgcagatcgacgcgacgaagctgccgacggtgcgg
ctcggcgattcgtcccgggtgcgcacgggcgagccggtgctgacgatcggcacgccggac
ggctcggcgaacacggtgacgacgggcatcgtcagcgcgacggcgcgcatgttgcccgac
ggcggccgctttccgttctttcagaccgacgtgaccggcaacctcgacaactcgggcggc
ccggtgttcaaccgcgcgggcgaggtgatcggcatcgatgtgcagatctacggcagcggc
gagcgcaatccgggcgtgacgtttgcgattccgatcgacatggcgatgaaggtgcgtgcg
caggtgctgcaggcgcagcgccaggcgcggcagcaggcgcagccgccgatgcaacaggcg
caacaggcgcaacaagcgccgcccgcggcggcgcagaacgcgctgggcgtcgacgcgcag
gacgtcggtccggggctcgcggcggcgttcggcctgccgcggccggcgggcgcgcttgtc
aatgcggtggagccggggtcgccggcggcggcggtcgggctgaagccgggcgacgtgatc
gtgcagatcggcgatcggccgctcggccgctcggcggaactggccggcgacctcgcggcg
ctgccgcccggggcgagcgcgccgatcacgctgatccgcaaccggatgccgatgacggtg
atgctcggctccggcgcggccgcgagcgcgccgacaggcgcgaccgcatcgccgggcaat
gcggccgccggccgcagcgagacgggcggcgcggaccgcctgggcctgacgatgcatccg
ctgacggacgacgagcggcgctcgacgggattgcccgtcggcatggtggtcgatgcggtg
cgcgggccggcggcgaacgcggggattcggccgggcgacgtcgtgctggagctcgacgat
acgctgatcgagacgccggacatggtgccggcgctggaggcgaaggcggggaaggtggtc
gcggtgctgattcagcgggggagcgagcgcaggttcgtgtcggtgaaggcgcggtga

DBGET integrated database retrieval system