KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1666Help
Entry
BURPS1106A_1666   CDS       T00480                                 

Definition
(GenBank) hydrolase, NUDIX family
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX Nudix_N_2 zf-NADH-PPase
Motif
Other DBs
NCBI-ProteinID: ABN90578
UniProt: A3NUB6
Position
I:1620588..1621139
Genome map
AA seq 183 aa AA seqDB search
MTTADYRFCPRCARALAERADPVDEGGRLRRACPDATCGYVHWNNPVPVVAAIVEYEGRI
LLARNAAWPEGMFALITGFLEHGETPEAGIAREVREETSLEAESVTLVGVYEFIRKNELI
IAYHVRASGTIRLSPELLEYRLIEAPKLRPWRAGTGQAVADWMRARGLEFEFVDFPGAVA
NPG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgccgactaccgcttctgtcctcgctgcgcgcgagcgctcgccgagcgcgcc
gatcccgtcgacgagggcggccgcctgcgccgcgcgtgccccgacgcaacctgcggctat
gtccactggaacaacccggtgcccgtcgtcgcggcgatcgtcgagtacgaaggccggatc
ctgctcgcgcgcaacgccgcgtggccggaaggcatgttcgcgctcatcaccggctttctc
gagcacggcgagacgcccgaggcgggcatcgcgcgcgaagtgcgcgaggaaacgtcgctc
gaggccgaatccgtgacgctcgtcggcgtctacgagttcatccgcaagaacgagctgatc
atcgcgtatcacgtgcgcgcgagcgggacgatccgcctgtcgcccgaattgctcgaatat
cggctcatcgaggcgccgaagctgcggccgtggcgcgcgggcaccggccaggcggtcgcc
gactggatgcgcgcgcgcgggctcgaattcgagttcgtcgattttcccggagcggtcgcg
aacccgggctga

DBGET integrated database retrieval system