KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1667Help
Entry
BURPS1106A_1667   CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbjQ_1 SeleniumBinding DUF4156
Motif
Other DBs
NCBI-ProteinID: ABN91121
UniProt: A3NUB7
Position
I:complement(1621239..1621574)
Genome map
AA seq 111 aa AA seqDB search
MADPQLITTAFDIPGYRIERSLGVARGIVVRSRSIVGTFGASIQTLFGGNISLYTSLCER
ARQDAYERMIDEARRMGGNAIVGMRYDATEIASGVTEVLCYGTAVQAVRAG
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggcagatccgcagctcatcacgaccgcattcgacatcccgggctaccggatcgagcgc
tcgctcggcgtcgcgcgcggcatcgtcgtgcgttcgcgctcgatcgtcggcacgttcggc
gcatcgattcaaacgctgttcggcggcaacatctcgctctacacgtcgctgtgcgagcgc
gcgcggcaggatgcctacgagcggatgatcgatgaggcgcggcgcatgggcggcaacgcg
atcgtcgggatgcgctacgacgccaccgagatcgcctcgggcgtgaccgaggtgctgtgc
tacggcaccgcggtgcaggcggtgcgcgccggctga

DBGET integrated database retrieval system