KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1671Help
Entry
BURPS1106A_1671   CDS       T00480                                 

Definition
(GenBank) ABC transporter, permease protein
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl02010  ABC transporters
bpl02024  Quorum sensing
Module
bpl_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BURPS1106A_1671
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BURPS1106A_1671
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpl02000]
    BURPS1106A_1671
Transporters [BR:bpl02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    BURPS1106A_1671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 DUF3481
Motif
Other DBs
NCBI-ProteinID: ABN89295
UniProt: A3NUC1
Position
I:1623635..1624570
Genome map
AA seq 311 aa AA seqDB search
MQSVVLDLLNGLSYGLLLFMLCAGLTLIFGMLGVLNFAHASFYMLGAYAGYAIAARTSFW
VALVAAPLAVGALGALCERTLLRRVRASGHLDELLLTFGLAYLIAEGVKLVWGLAPLAAP
VPAALDGAAFTIYGAVFSRYRAFMMLVSIAMLGALWAVLRASRTGLVVRAALTRRAAVEA
LGHDVPRVMTLVFAAGTALAALAGVIGAPLAVIEPAMAQTLGSVVFAVIVIGGLGSLAGA
LVASLVLGCAQTFAAASRASLSDAAQWAGIALPDAWRALTLAQFAPLIPYLLLIVVLACR
ARGLFGERADV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtcggtcgtcctcgatctgctcaacggcctgagctacggcctgttgctgttcatg
ctgtgcgcggggctcacgctgatcttcggcatgctcggcgtgctcaatttcgcgcacgcg
agcttctacatgctcggcgcgtacgcgggctacgcgatcgccgcgcgcacgagcttctgg
gtcgcgctcgtcgccgcgccgctcgccgtcggcgcgctcggcgcgctgtgcgagcgcacg
ctgctcaggcgggtgagggcgagcggccatctcgacgaattgctgctcacgttcgggctc
gcgtatctgatcgccgaaggcgtgaagctcgtctgggggctcgcgccgctcgccgcgccg
gtgcccgccgcgctcgacggcgcggcgttcaccatctacggcgcggtgttttcgcgttat
cgcgcgttcatgatgctcgtgtcgatcgcaatgctcggcgcgctgtgggcggtgctgcgc
gcctcgcggacggggctcgtcgtgcgcgcggcgctcacgcggcgcgcggccgtcgaggcg
ctcggccacgacgtgccgcgcgtgatgacgctcgtgttcgccgcgggcaccgcgctcgcc
gcgctcgccggcgtgatcggcgcgccgctcgcggtgatcgagcccgcgatggcgcagacg
ctcggctcggtcgtgttcgcggtcatcgtgatcggcgggctcggctcgctcgcgggcgcg
ctcgtcgcgtcgctcgtgctcggctgcgcgcagacgttcgccgcggcgagccgcgcgtcg
ctgagcgacgcggcgcagtgggcgggcatcgcgctgcctgacgcgtggcgcgcgttgacg
ctcgcgcagttcgcgccgttgattccgtatctgctgctgatcgtggtgctcgcgtgccgc
gcgcgcggcctgttcggcgagcgcgccgatgtctag

DBGET integrated database retrieval system