KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1672Help
Entry
BURPS1106A_1672   CDS       T00480                                 

Definition
(GenBank) ABC transporter, permease/ATP-binding protein
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
K01998  branched-chain amino acid transport system permease protein
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl02010  ABC transporters
bpl02024  Quorum sensing
Module
bpl_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BURPS1106A_1672
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BURPS1106A_1672
Transporters [BR:bpl02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    BURPS1106A_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 ABC_tran AAA_21 BCA_ABC_TP_C AAA_29 AAA_23 RsgA_GTPase MMR_HSR1 SMC_N Mucin
Motif
Other DBs
NCBI-ProteinID: ABN91909
UniProt: A3NUC2
Position
I:1624599..1626839
Genome map
AA seq 746 aa AA seqDB search
MPEALAWLAFVALLVVPALAWPRGWMLGYLAQTAAMIVLALSYNLLLGTTGLLSFGHAAF
AGLGAFVAAHGFNRYGLPLPLVPLAGGAAGAAFGALFGFVATRRAGTAFAMITLGIGELV
AAAAWSVPEWFGGAGGVSIDRAAGPALAGWEFGKPMHAYALIAAWCVVAAVAMRVLVRTR
LARLANAVRDNPARVAALGTDPCRVRFAMAIAAAFFAGVAGALTLIDVEVATAESVGMLR
SGAVLFATVIGGTTAFFGPVVGAVLLTFFSVFVASVSRAWLLYLGLLFVAVVLAAPGGAS
GRWRAWRDARRHGGARFDARRALPGAGAALAGGVAIVFAAELAYALQFAQNDARRAVIGP
WRFDAGAPLGWGIAALAAALGMGLAHAARRWGRGAPRTNGPAFADAIDTCGAACGSAELK
ARDAGDVDGSTNAASAANETNAVSIASTTSTTSTTSMTSMTSTTSARHAARVSDNAPSPV
FEVAAEPVGGGVHAASAPPALRMADVSKSFGATPVLVGIDLTIRPGERHALIGPNGAGKS
TLFNLIAGALAPTRGRIALNGIELGRRRPHAVARLGLARSFQQTSVFARMSVYDNLRCAA
LHAPRARRRWRRGPAAAAAIDRAADAALASIGLAAHRDALAGSLSYAQQRALDVGLALAS
GASVFLFDEPTAGMSREQARRTIELIRRATAGKTVLMIEHDMDAVFGFADRVSVLVRGEL
VATGSPAAIRANAAVRAAYLGEAFER
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
ttgccggaggcgctggcgtggctcgcgttcgtcgcgctgctcgtcgtgcccgcccttgcg
tggccgcgcggctggatgctcggctatctcgcgcagacggccgcgatgatcgtgctcgcg
ctgtcgtacaacctgctgctcggcacgacggggttgctgtcgttcgggcacgcggcgttc
gcggggctcggcgcgttcgtcgccgcgcacggcttcaatcgctacggcctgccgctgccg
ctcgtgccgctcgcgggcggtgccgcgggcgcggcgttcggcgcgctgttcggcttcgtc
gcgacgcgccgcgcgggcaccgcgttcgcgatgatcacgctcgggatcggcgagctcgtc
gcggccgccgcgtggagcgtgcccgagtggttcggcggcgcgggcggcgtgtcgatcgac
cgcgcggcgggcccggcgctcgccgggtgggagttcggcaaaccgatgcatgcgtatgcg
ttgatcgccgcatggtgcgtcgtcgcggcggtggcgatgcgggtgctcgtgcgcacgcgc
ctcgcgcggctcgcgaacgcggtgcgcgacaatccggcgcgcgtcgccgcgctcggcacc
gatccgtgccgcgtgcgcttcgccatggcgatcgcggcggcgttctttgccggcgtggcg
ggcgcgctgacgctgatcgacgtcgaggtcgcgacggcggagagcgtcgggatgctgcgc
tcgggcgcggtgctgttcgcgacggtgatcggcgggacgacggcctttttcggccccgtc
gtcggcgcggtgttgctgacgttcttcagcgtgttcgtcgcgagcgtgtcgcgcgcgtgg
ctgctgtaccttgggctgctgttcgtcgccgtggtgctggccgcgccgggcggcgcgagc
ggccggtggcgcgcgtggcgcgacgcgcggcggcacgggggcgcgcgcttcgatgcgcga
cgcgcgttgcccggcgcgggcgcggcgctcgccggcggcgtcgcgatcgtgttcgccgcc
gagctcgcatatgcgctgcagttcgcgcagaacgatgcgcggcgcgcggtgatcgggccc
tggcgattcgatgcgggcgcgccgctcggctgggggatcgcggcgctcgcggcggcgctc
ggcatggggctcgcgcatgcggcgcggcggtgggggcgcggcgcgcctcgcacgaatggg
ccggcgtttgccgatgcgatcgatacgtgcggcgcggcgtgcggatcggcggagctgaag
gcgcgcgatgcgggcgatgtggacggttcgacaaacgcggcgagcgcggcaaacgagacc
aacgcggtgagcattgcaagcacgacaagcacgacaagcacgacaagcatgacaagcatg
acaagcacgacaagcgcgcgtcatgccgcccgcgtgtccgacaatgccccgtcgccggtg
ttcgaggtcgccgccgagcccgtcggcggtggcgtgcacgcggcgagcgcgccgcccgcg
ctgcgcatggcggacgtgagcaaatcgttcggcgcgacgccggtgctcgtcggcatcgat
ctgacgatccgccccggcgagcgccatgcgctgatcggcccgaacggcgcaggcaaatcg
acgctcttcaatttgatcgcgggcgcgctcgcgccgacgcgcggccgcatcgcgctgaac
ggcatcgagctcgggcggcggcggccgcatgcggtcgcgcgccttggcctcgcgcgtagc
tttcagcagacgagcgtgttcgcgcggatgagcgtctacgacaatctgcgatgcgcggcg
ttgcacgcgccgcgcgcgcgccgccgctggcgacgcgggccggccgccgcggccgcgatc
gatcgcgcggccgacgccgcgctcgcgtcgatcggcctcgccgcgcatcgcgacgcgctc
gcgggcagcctgagctacgcgcagcagcgcgcgctcgacgtcgggctcgcgctcgcgagc
ggcgcgtcggtgtttctgttcgacgagccgaccgcggggatgagccgcgagcaggcgcgg
cgcacgatcgagctgatccgtcgcgcgacggcgggcaagacggtgctgatgatcgagcat
gacatggacgcggtgttcggcttcgccgatcgcgtgtcggtgctcgtgcgcggcgagctg
gtggccaccggctcgcccgcggcgatccgcgcgaacgcggccgtgcgcgccgcgtatctc
ggcgaggcgttcgagcgatga

DBGET integrated database retrieval system