KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1684Help
Entry
BURPS1106A_1684   CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TusA
Motif
Other DBs
NCBI-ProteinID: ABN91726
UniProt: A3NUD4
Position
I:1639848..1640078
Genome map
AA seq 76 aa AA seqDB search
MLIHKEVDARGLNCPLPILRAKKALADMESGQILKVLATDPGSQRDFAAFAKQTGNEIVE
SSTTQDKTFVFLMRRR
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgctcattcacaaggaagtggacgcgcgcgggctgaattgcccgctgccgatcctgcgc
gcgaagaaagcgctcgccgacatggaaagcggccagattctgaaggtgctcgccaccgat
cccggctcgcagcgcgacttcgccgcgttcgcgaagcagacgggcaacgaaatcgtcgaa
tcgtcgacgacgcaggacaagacgttcgtcttcctgatgcgtcgccgctga

DBGET integrated database retrieval system