KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_1773Help
Entry
BURPS1106A_1773   CDS       T00480                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00020  Citrate cycle (TCA cycle)
bpl00310  Lysine degradation
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
bpl01200  Carbon metabolism
Module
bpl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BURPS1106A_1773 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BURPS1106A_1773 (sucB)
Enzymes [BR:bpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BURPS1106A_1773 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABN89568
UniProt: A3NUM1
Position
I:1736460..1737725
Genome map
AA seq 421 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASSTA
AASPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPAAAPAKAAAKPALPEVKVP
ASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYKDKF
EKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPIL
RNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSA
ILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARLLLD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgagctc
gagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcaggtg
ctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacaccgaa
gcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagccggccgccgct
cccgtcgccgcgccggcgcccgccgcacagccggccgccgccgccgcgtcgagcaccgcg
gccgcatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgacgtc
gccggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcg
ccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaagtgaaggtgccg
gcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccgatgtcgcgcctg
cgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcgatcctcacgacg
ttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtacaaggacaagttc
gagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcggccgttcac
gcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgacatcgtctaccac
ggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtcgtgccgatcctg
cgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgccgaattcggccag
aaggcaaaggacggcaagctgtcgatcgaggaaatgacgggcggcacgttctcgatctcg
aacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccgccgcagtcggcg
atcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggccagatcgtgatc
cgcccgatcaactatctcgcgctgtcgtacgaccaccggatcatcgacggtcgcgaagcg
gtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgcctgctgctcgac
ctgtaa

DBGET integrated database retrieval system