KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2023Help
Entry
BURPS1106A_2023   CDS       T00480                                 

Definition
(GenBank) L-allo-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00260  Glycine, serine and threonine metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
bpl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BURPS1106A_2023
Enzymes [BR:bpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BURPS1106A_2023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_3 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABN92140
UniProt: A3NVB7
Position
I:1988294..1989454
Genome map
AA seq 386 aa AA seqDB search
MTRTTAAAKAAVSTTNRRSEAGRPNQWIDAMIDFLSDTVTLPTAEMRHAMFTANVGDDCY
GEDPTVNELESVAAGLTGKEAAAFVTSGTLGNLSALLAQCPRGHEVILGDRSDLYNYEAG
GVSLVGGAVLHPVETADDGSLPLERLRAAIRDKRDPQCAPAAVIALENPHCLAGGRVLSL
DYLRRVRALADEHGLAVHMDGARLFNAQASLGTPAAEIVAHVDSVQFCLSKSLAAPYGSM
VCGSAALIDRVKRYRKLLGGGTRQAGIMAAAGLVALRTMVARLADDHRRAARLAAELARI
PGVALRSAVIETNMVFFDVAEPGNEAFLAALRDAGIRMGVLGDGVIRAVVHYMIDDDAIS
RTVDAVRAIVLPFAPALAPAAASQAQ
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcacgacggcggccgcgaaggcggccgtctcgacgacgaaccggcgcagcgag
gccggacgacccaaccaatggatcgatgcgatgattgatttcctgagcgacacggtgacg
ctgccgaccgcggagatgcggcacgcgatgtttaccgcgaatgtgggcgacgattgctat
ggcgaggatccgacggtcaacgagctcgaatcggtggcggccggactgaccggcaaggaa
gcggcggcgttcgtcacgagcggcacgctcggcaacctgagcgcgctgctcgcgcaatgc
ccgcgcgggcacgaggtgatcctcggcgatcgctccgacctgtacaactacgaggcgggc
ggcgtgtcgctcgtcggcggcgcggtgttgcaccccgtcgagaccgccgacgacggcagc
ctgccgctcgagcggctgcgcgcggcgatccgcgacaagcgcgacccccagtgcgcgccc
gccgcggtgatcgcgctcgagaatccgcattgcctcgccggcggccgcgtgctgtcgctc
gactacctgcggcgcgtgcgcgcgctcgccgacgagcacgggctcgccgtgcacatggac
ggcgcgcgtctgttcaacgcgcaggcgagcctcggcacgccggcggccgagatcgtcgcg
cacgtcgattcggtccagttctgcctgtcgaagagcctcgccgcgccgtacggctcgatg
gtgtgcggcagcgccgccctgatcgatcgcgtgaagcgctatcggaagctgctcggcggc
ggcacgcggcaagccggcatcatggcggccgccgggctcgtcgcgctgcgcacgatggtc
gcgcggctcgcggacgatcaccgccgcgcggcgcgcctcgccgcggagctggcgcggatt
ccgggcgtcgcgctgcgctcggcggtgatcgagacgaacatggtgttcttcgacgtcgcc
gagccgggcaacgaggcgtttctcgccgcgctgcgcgacgcgggcatccggatgggcgtg
ctcggcgacggcgtgatccgggccgtcgtgcactacatgatcgacgacgacgcgatcagc
cgcaccgtcgacgccgtccgcgcgattgttcttccgttcgccccggcgttagcgccggcc
gccgcatcgcaggcgcaatga

DBGET integrated database retrieval system