KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2473Help
Entry
BURPS1106A_2473   CDS       T00480                                 

Definition
(GenBank) serine protease, subtilase family
  KO
K05998  pseudomonalisin [EC:3.4.21.100]
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bpl01002]
    BURPS1106A_2473
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.100  sedolisin
     BURPS1106A_2473
Peptidases [BR:bpl01002]
 Serine Peptidases
  Family S53
   BURPS1106A_2473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Motif
Other DBs
NCBI-ProteinID: ABN91429
UniProt: A3NWL1
Position
I:complement(2426984..2428870)
Genome map
AA seq 628 aa AA seqDB search
MTSRKWARPRASQAKHAIYAATFFAAAALSAHAAAAWVDTQTGAYPALAQQALAASQASA
AATAAGKAIDTAPGEPVRVVVSLNLNDEARLDRFLRDLHTPGSAAYGRHLTPAEFAAQYA
PTPQQVALVEAHLRRAGFRDIEVAPNRLLISATGTAAAVKTAFNTRLKRFTLEGRRVYAN
QDAAQVPAELGRIVGAVLGLDNATLARTYNRQAAVTGAVGGAKASLAARASDASAAASGA
PVLTGHDPLEFSRIYRAGSTPTASQTTVGVIMAGDAAPVLRDLDTFAAKAGLARVAATVT
RTGPPGSDYSDNSGLSEWDMDSQAIVGAAGGAVKGLVLYAAPSMLLSDITSAYNRAVVDN
VAKVINVSLGVCEADARASGTQAADDRIFKSAVAQGQTFVVAAGDAGAYECSVSRVSGGQ
GVPARSNYSVSEPATSPYVVAVGGTTLSTDRTTLAYAGEVAWNEGLQPIGVYDAYGSYDG
TRRLWATGGGYSRSEAAPAWQRSVLGASAKARALPDVAFDADGRSGAHVYVNGRTEQWGG
TSLAAPIFTGIWARVQSDNGNRLGFPLASLYRYAPANGAFAHDVKSGNNGSGGYGYKAGA
GWDPVTGFGSLDIANFAAFVKQTADFAR
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaagaaaatgggccaggcctcgcgcttcgcaggcgaagcatgcgatttacgcg
gcgacgttctttgccgcggcggcattgagcgcgcacgcggcggcggcatgggtcgacacg
caaaccggcgcgtatccggcgcttgcgcagcaggcgcttgccgcgtcgcaagcttcggcg
gcggcaaccgcggccggaaaggcgatcgacacggcgcccggcgagccggtgcgggtcgtc
gtcagtctcaatctcaacgacgaagcgaggctcgatcgcttcctgcgcgatctgcatacg
cccggcagtgccgcctacggccggcatctgacgcccgccgaattcgccgcgcagtatgcg
ccgacgccgcagcaggtcgcgctcgtcgaagcgcatctgcgccgggccggattccgcgac
atcgaggtggcgccgaaccggctgttgatctcggcgacgggcaccgccgccgcggtcaag
acggcgttcaacacgcggctcaagcgctttacgctcgaaggccggcgcgtgtatgcgaac
caggacgcggcgcaggtgcccgccgagctcggccgaatcgttggcgcggtgctcgggctc
gataatgcgacgctcgcgcgcacgtacaaccgccaggcggcggtgacgggcgcggtcggc
ggcgcgaaggcgtcgctggccgcgcgcgcgagcgacgcgtcggccgccgcgagcggcgcg
cccgtgctgacgggacacgatccgctcgaattctcgcgaatctatcgcgcgggctcgacg
ccgacggcgtcgcagacgacggtcggcgtgatcatggcgggcgatgcggcgcccgtgctg
cgggatctcgatacgttcgcggcgaaggccgggctcgcgcgcgtcgcggcgacggtcacg
cgtaccgggccgcccggcagcgattacagcgacaattcgggcctgagcgaatgggatatg
gacagccaggcgatcgtcggcgcggcgggcggcgcggtgaaggggcttgtgctctacgcg
gcgccctcgatgctgctctccgacatcacctcggcgtacaaccgcgcggtcgtcgacaac
gtcgcgaaggtgatcaacgtgtcgctcggcgtgtgcgaggcggacgcacgcgcgtccggc
acgcaggcggcggacgaccgcatcttcaagagcgcggtcgcgcaggggcagacgttcgtc
gtcgcggcgggcgacgcgggcgcgtacgaatgcagcgtgagccgcgtgtcgggcgggcag
ggcgtgccggcgcgatcgaactattcggtgagcgagcctgcgacgtcgccgtacgtcgtc
gcggtcggcggcacgacgctgtcgaccgacaggacgacgctcgcctacgcgggcgaagtc
gcatggaacgagggtttgcagccgatcggcgtgtacgacgcgtacggcagctacgacggc
acgaggcgtctgtgggcgacgggcggcggctacagccgaagcgaagcggcaccggcgtgg
cagcgaagcgtgctcggcgcgtcggcgaaagcgcgcgcgctgcccgatgtcgcattcgat
gcggacggccgcagcggcgcgcacgtctacgtgaacggccggaccgagcaatggggcggc
acgagcctcgcggcgccgatcttcacgggcatctgggcgcgcgtgcaatccgacaacggc
aaccggctcggttttccgctcgcgagcctctatcgctacgcgccggccaacggcgcgttc
gcgcatgacgtgaaatccggcaacaacggctcgggcggctatggctacaaggccggtgcg
ggctgggatccggtgacgggcttcggcagcctcgacatcgcgaacttcgccgcgttcgtc
aagcagacggccgatttcgcgcgataa

DBGET integrated database retrieval system