KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2480Help
Entry
BURPS1106A_2480   CDS       T00480                                 

Gene name
lpxA
Definition
(GenBank) acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
  KO
K00677  UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00540  Lipopolysaccharide biosynthesis
bpl01100  Metabolic pathways
bpl01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BURPS1106A_2480 (lpxA)
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BURPS1106A_2480 (lpxA)
Enzymes [BR:bpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     BURPS1106A_2480 (lpxA)
Lipopolysaccharide biosynthesis proteins [BR:bpl01005]
 Lipid A
  BURPS1106A_2480 (lpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_11 Hexapep Hexapep_2
Motif
Other DBs
NCBI-ProteinID: ABN91066
UniProt: A3NWL8
Position
I:complement(2433036..2433824)
Genome map
AA seq 262 aa AA seqDB search
MSRIHPTAIIEPGAQLHETVEVGPYAIVGSHVTIGARTTIGSHSVIEGHTTIGEDNRIGH
YASVGGRPQDMKYKDEPTRLVIGDRNTIREFTTIHTGTVQDTGVTTLGDDNWIMAYVHIG
HDCRVGSHVILSSNAQMAGHVEIGDWAIVGGMSGVHQFVRIGAHSMLGGASALVQDIPPF
VIAAGNKAEPHGINVEGLRRRGFSPDAISALRSAYRILYKNSLSLEEAKVQLSELAQAGG
DGDAAVKSLVDFVESSQRGIIR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagcaggattcaccccacggcgatcatcgagccgggcgcgcagctccacgagacggtc
gaggtcggcccgtacgcgatcgtcggttcgcacgtgacgatcggcgcgcgcacgacgatc
ggctcgcacagcgtgatcgaaggccatacgacgatcggcgaagacaatcgcatcggccat
tacgcgtcggtgggcggccgtccgcaggacatgaagtacaaggacgagccgacgcggctc
gtgatcggcgatcgcaacacgatccgcgaattcacgacgatccatacgggcaccgtccag
gacacgggcgtcacgacgctcggcgacgacaactggatcatggcgtacgtgcacatcggc
catgactgccgtgtcggcagccacgtgatcctgtcgagcaacgcgcagatggcggggcac
gtcgagatcggcgattgggcgatcgtcggcgggatgtcgggcgttcaccagttcgtgcga
atcggcgcgcattcgatgctgggcggcgcatcggcgctcgtgcaggacattccgccgttc
gtgatcgcggcgggcaacaaggccgagccgcatgggatcaacgtcgaagggctgcgccgc
cgaggcttttccccggatgcgatctccgcgctgcgcagcgcgtaccggatcctctacaag
aacagcctgtcgctcgaggaggcgaaggtccagctgagcgagctcgcgcaggcgggcggc
gacggcgatgcggcggtgaagtcgctcgtcgacttcgtcgagtcttcgcagcgcggcatc
attcgctga

DBGET integrated database retrieval system