KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2804Help
Entry
BURPS1106A_2804   CDS       T00480                                 

Gene name
plcN_1
Definition
(GenBank) non-hemolytic phospholipase C
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00562  Inositol phosphate metabolism
bpl00564  Glycerophospholipid metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BURPS1106A_2804 (plcN_1)
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BURPS1106A_2804 (plcN_1)
   00565 Ether lipid metabolism
    BURPS1106A_2804 (plcN_1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BURPS1106A_2804 (plcN_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bpl02042]
    BURPS1106A_2804 (plcN_1)
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BURPS1106A_2804 (plcN_1)
Bacterial toxins [BR:bpl02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BURPS1106A_2804 (plcN_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal UCR_Fe-S_N
Motif
Other DBs
NCBI-ProteinID: ABN90966
UniProt: A3NXI4
Position
I:2762626..2764728
Genome map
AA seq 700 aa AA seqDB search
MTNQNRRDFLRLAAGTAGAAALQLFPPVIREALAIPANRRTGTIRDVEHIVILMQENRSF
DHYFGKLRGVRGFGDPRPLALQNGKSVFHQPVLLGPAELLPFHPDASNLGMQFLQDLPHG
WQDMHGAWNKGRYDRWIANKGTTTMAYLERDDIPFHYQLADAFTICDAYHCSIPSSTDPN
RYYMWTGYVGNDGAGGGPVLGNEEAGYGWSTYPETLEQAGVSWKIYQDIGTGLDAAGSWG
WTQNPYIGNYGDNSLLYFNQYRNAQPGSPLYDKARTGTNVSAGGTLFDVLQQDVKNGTLP
QVSWICAPEAYSEHPNWPANYGAWYVEQVLKALTSNPDVWSKTALFITYDENDGFFDHVA
PPFAPQSRENGLSTVSTAGEIFAGDATHMAGPYGLGPRVPMLVVSPWTKGGWVCSQTFDH
TSLLQFIEARFNDRYSVRAPNVTPWRRAVCGDLTSAFNFSSPDGSWPQLPDTSGYAPPDR
NRHPSYVPVPPAAQSMPKQEAGLRAARALPYELFVLGRIDQSTGKFKLTFANTGRAGAAF
QVTAGNRLDGPWAYTVEARKRLSDEWSTALTLSIYDLTVYGPNGFLCQFRGSTAAALGLS
ANPEVIYGYDVANGNITLRLSNRGRAAVRLTVTNAYGNAAPRVYELKPGQRINDYWDLRD
SHSWYDLSVSDGAPNGFLRRFAGHVETGRPSTSDPLIATA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatcagaatcgccgggactttctgcgcctcgccgccggcacggcgggcgcggcc
gcgctgcagctctttccgcccgtgatccgcgaagcgctcgcgattcccgcgaaccgccgc
accggcacgatccgcgacgtcgagcacatcgtgatcctgatgcaggaaaaccgctcgttc
gatcattacttcggcaagctgcgcggcgtgcgcggcttcggcgatccgcgcccgctcgcg
ctgcagaacggcaagtcggtgttccatcagccggtgctcctcggcccggccgagctgctg
ccgttccatccggacgcgtcgaatctcggcatgcagttcctgcaggatctgccgcacggc
tggcaggacatgcacggcgcatggaacaaggggcgctacgaccgctggatcgcgaacaag
ggcacgacgacgatggcctacctcgagcgcgacgacatcccgttccactaccagctcgcc
gacgcgttcacgatctgcgacgcgtaccactgctcgatcccgagctcgaccgacccgaac
cgctactacatgtggacgggctacgtcggcaacgacggcgcgggcggcggcccggtgctc
ggcaacgaggaggccggctacggctggagcacgtatccggagacgctcgagcaggcgggc
gtgtcgtggaagatctatcaggacatcggcacgggcctcgacgcggcgggctcgtggggc
tggacgcagaacccgtacatcggcaactacggcgacaattcgctcctctatttcaaccag
taccgcaacgcgcagccgggcagcccgctgtacgacaaggcgcgcacgggcacgaacgtg
agcgcgggcggcacgctgttcgacgtgttgcagcaggacgtgaagaacggcacgctgccg
caggtgtcgtggatctgcgcgccggaagcgtattccgagcacccgaactggccggcgaac
tacggcgcgtggtacgtcgagcaggtgctgaaggcactgacgtcgaacccggacgtctgg
agcaagaccgcactcttcatcacgtacgacgaaaacgacggcttcttcgatcacgtcgcg
ccgccgttcgcgccgcaatcgcgcgagaacggactgtcgacggtgtcgaccgcgggcgag
atcttcgcgggcgacgccacgcacatggccgggccgtacgggctcggaccgcgcgtgccg
atgctcgtcgtgtcgccgtggacgaagggcggctgggtctgctcgcagacgttcgatcac
acgtcgctgctgcaattcatcgaggcgcgcttcaacgatcgctactcggtgcgcgcgccg
aacgtgacgccgtggcgccgcgcggtgtgcggcgatctcacgtccgcgttcaacttctcg
agcccggacggcagctggccgcaactgcccgacacgagcggctacgcgccgcccgatcgc
aaccgccatccgagctacgtgccggtgccgcccgccgcgcagtcgatgccgaaacaggag
gccggcctgcgcgccgcgcgcgcgctgccgtacgagctcttcgtgctcggccgcatcgat
cagtcgaccggcaagttcaagctgaccttcgcgaacacgggccgggcgggcgcggcgttc
caggtgacggccggcaaccgcctcgacggcccgtgggcgtatacggtcgaagcgcgcaag
cggctgtccgacgaatggagcacggcgctcacgctgagcatctacgatctgaccgtctac
ggcccgaacggcttcctgtgccagttccgcggctcgaccgcggcagcgctcggcttgagc
gcgaacccggaggtgatctacggctatgacgtcgcgaacggcaacatcacgctgcgcctg
tcgaaccgcggccgcgcggcggtgcggctcacggtcacgaacgcgtacggcaacgcagcc
ccgcgcgtctacgagctgaagcccggccagcggatcaacgactactgggatctgcgcgac
agccacagctggtacgacctgagcgtctccgacggcgcgccgaacggcttcctgcgccgc
ttcgcgggacacgtcgagacgggccggccgagcacgagcgatccgctgatcgcgacggcc
tga

DBGET integrated database retrieval system