KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_2954Help
Entry
BURPS1106A_2954   CDS       T00480                                 

Gene name
ubiG
Definition
(GenBank) 3-demethylubiquinone-9 3-methyltransferase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00130  Ubiquinone and other terpenoid-quinone biosynthesis
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BURPS1106A_2954 (ubiG)
Enzymes [BR:bpl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     BURPS1106A_2954 (ubiG)
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     BURPS1106A_2954 (ubiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_12 PrmA CMAS MTS Ubie_methyltran NodS Methyltransf_9 MetW TPMT Methyltransf_32 Methyltransf_18 TehB AdoMet_MTase
Motif
Other DBs
NCBI-ProteinID: ABN92569
UniProt: A3NXX8
Position
I:2898831..2899574
Genome map
AA seq 247 aa AA seqDB search
MAGAPPPSFPHPLADMTNADPHELQKFSDLAHKWWDPNAEFKPLHDLNPVRLSWIDAHAH
LPGKRVVDIGCGGGILSESMASLGAQVKGIDLATEALGVADLHSLESGVSVDYEAIAAEA
LAAREPGAYDVVTCMEMLEHVPSPANIVAACATLVKPGGWVFFSTLNRNLKSYLLAVIGA
EYIAQMLPKGTHDYARFIRPSELARFVREAGLQMVEIKGIAYHPLAKRFALSNDTDVNYL
VACRRGA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
ttggcgggcgcgccgccgccctctttcccgcatccgcttgccgacatgacgaacgccgat
ccgcacgaactccagaaattcagcgacctcgctcacaaatggtgggatccgaacgccgaa
ttcaagcctctgcacgacctcaatccggttcgcctgagctggatcgacgcgcacgcgcat
ttgcccggcaagcgcgtcgtcgacatcggctgcggcggcggcatcctgtctgaatcgatg
gcgtcgctcggcgcgcaggtcaagggcatcgaccttgcgacggaagcgctcggcgtcgcc
gatctgcacagcctcgaaagcggcgtgagcgtcgattacgaggcgatcgcggccgaagcg
ctcgccgcgcgcgaaccgggcgcgtacgatgtcgtcacgtgcatggagatgctcgagcac
gtgccgtcgcccgcgaacatcgtcgccgcgtgcgcgacgctcgtgaagccgggcggctgg
gtgttcttctcgacgctgaaccgcaacctgaagtcgtacctgctcgccgtgatcggcgcc
gaatacatcgcgcaaatgctgccgaagggcacgcacgactacgcgcgcttcatccgcccg
tccgagctcgcgcgcttcgtgcgcgaagcgggcctgcagatggtcgagatcaagggcatc
gcctatcatccgctcgcgaagcgcttcgcgctgtcgaacgacaccgacgtcaactatctc
gtcgcgtgccgccgcggcgcctga

DBGET integrated database retrieval system