KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3055Help
Entry
BURPS1106A_3055   CDS       T00480                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00010  Glycolysis / Gluconeogenesis
bpl00052  Galactose metabolism
bpl00500  Starch and sucrose metabolism
bpl00520  Amino sugar and nucleotide sugar metabolism
bpl00521  Streptomycin biosynthesis
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
bpl01200  Carbon metabolism
Module
bpl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1106A_3055 (glk)
   00052 Galactose metabolism
    BURPS1106A_3055 (glk)
   00500 Starch and sucrose metabolism
    BURPS1106A_3055 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS1106A_3055 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BURPS1106A_3055 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BURPS1106A_3055 (glk)
Enzymes [BR:bpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BURPS1106A_3055 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK LacI HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ABN92617
UniProt: A3NY73
Position
I:2984428..2986353
Genome map
AA seq 641 aa AA seqDB search
MSTGAQTKAAAASQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIR
KYLKDAKIGRVNHAAIAIANPVDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGTRRQNSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAP
MDEREDLVLQYARRKYPHVSFERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHA
GDALALEAVECFCAILGTFAGNLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKG
RFEAYLANIPTYLITAEYPAFLGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAA
PNAELAEAMARAKARAGASAGDEAADVLDWLSHGAAPAAKD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaactaaggccgccgcggcgagccagcacgcggacgggccgcgc
ctattggccgacgtcggcggcacgaacgcgcgcttcgcgctcgagacgggcccgggagaa
atcacgcagatccgcgtgtacccgggcgccgagtatccgacgctcaccgacgcgatccgc
aagtacctgaaggacgcgaagatcggccgcgtgaatcacgcggcgatcgcgatcgcgaac
cccgtcgacggcgatcaggtccggatgacgaatcacaactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgatttcaccgcgctcgcg
atggcgctgcccggcctgaccgatgcgcagcgcgtacagatcggcggcggcacgcgccgg
cagaacagcgtgatcggcctgatggggccgggcacggggctcggcgtgtcggggctcatt
cccgccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcgacgttcgcgccg
atggacgagcgcgaggatctcgtgctgcaatacgcgcgccgcaagtatcctcacgtgtcg
ttcgagcgcgtgtgcgcgggcccgggcatggagatcatctatcgcgcgctcgccgcgcgc
gacaagaagcgcatcgccgcgaacgtcgacacggccgacatcgtcgagcgcgcgcacgcg
ggcgatgcgctcgcgctcgaggcggtcgagtgcttctgcgcgattctcggcacgttcgcc
ggcaacctcgcggtcacgctcggcgcgttgggcggcatctatatcggcggcggcgtcgtg
ccgaagctcggcgagctgttcatgcgctcgccgtttcgcgcgcgcttcgaggcgaagggc
cgcttcgaggcgtatctcgcgaacatcccgacctacctgatcaccgcggaatacccggcg
tttctcggcgtatcggcgatcctcgccgagcaactgtcgaaccgcacgggcggcgcgtcg
tcggccgtgttcgagcgcatccgccagatgcgcgacgcgttgacgcccgccgagcggcgc
gtcgccgatctcgcgctcaaccatccgcgctcgatcatcaacgatccgatcgtcgacatc
gcgcgcaaggccgacgtgagccagcccaccgtgatccgcttctgccgctcgctcggctgc
caggggctgtcggacttcaagctgaagctcgcgacgggcctcaccggcacgatcccgatg
agccacagccaggtgcatctgggcgacaccgcgaccgatttcggcgcgaaggtgctcgac
aacacggtatcggcgatccttcagttgcgcgagcatctgaacttcgagcacgtcgagcag
gcgatcgacatcctgaacaacgcgcggcgcatcgagttctacggcctgggcaattcgaac
atcgtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtac
ggcgacctgtacatgcaggcggcgtcggccgcgctcctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtcggggcgcgcgccggagctgttgcgcgtgctcgacgtcgcgatgcag
gcgggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgccaagcgcgcgacg
gtcgcgctcgagaccgatcacatcgagatgcgcgagtcgcagttgtcgatgatctcgcgg
atcctgcatctcgtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgccgcg
ccgaacgcggagctcgcggaggcgatggcgcgcgcgaaggcgcgcgcgggcgcgagcgcg
ggcgacgaggccgccgacgtgctcgactggctgagccacggcgcggcgcccgcggcgaag
gactga

DBGET integrated database retrieval system