KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3322Help
Entry
BURPS1106A_3322   CDS       T00480                                 

Definition
(GenBank) hydrolase, carbon-nitrogen family
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BURPS1106A_3322
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BURPS1106A_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABN91724
UniProt: A3NYY8
Position
I:3245506..3246333
Genome map
AA seq 275 aa AA seqDB search
MTDRHASASPFPVAALQMVSTPDRERNLAEAGRLIADAAASGARLVLLPEYFCFMGHQDT
DKLALAEAYRDGPIQRFLAERAKAHGIWVIGGTLPLKAPEPSRVLNTTLVFDPQGREAAR
YDKIHLFNFEKGDESFDEARTIRPGDAVRTFDAPFGRVGLSVCYDLRFPELYRRMGDCAM
IVVPSAFTYTTGRAHWETLLRARAVENQCYVLAAAQGGKHENGRRTWGRSMLVDPWGEIV
AVRDEGAGVVAGEIDPARIADVRQSLPAWRHRVLA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgccacgcctcagcctcgccgttcccggtcgccgcgctgcagatggtcagc
acgcccgatcgcgagcgcaatctcgccgaagccggccggctgatcgccgatgcggcggcc
tcgggcgcacggctcgtgctgctgcccgaatatttctgcttcatgggccaccaggacacc
gacaagctcgcgctcgcggaagcgtaccgtgacggcccgatccagcgctttctcgccgag
cgcgcgaaggcgcacggcatctgggtgatcggcggcacgctgccgctgaaggcgcccgag
ccgtcgcgcgtgctgaacacgacgctcgtgttcgatccgcaaggccgcgaggccgcccgc
tacgacaagatccacctgttcaacttcgagaagggcgacgagtcgttcgacgaggcgcgc
acgatccgcccgggcgacgcggtgcgcacgttcgacgcgccgttcggccgggtcgggctg
tcggtctgctacgatctgcgctttccggagctgtaccggcgaatgggcgactgcgcgatg
atcgtcgtgccgtcggcgttcacgtacacgacagggcgcgcgcactgggagacgctgttg
cgcgcccgcgcggtcgagaaccagtgctacgtgctcgccgccgcgcaaggcggcaagcac
gagaacggccgccgcacgtggggccgcagcatgctcgtcgatccgtggggcgagatcgtc
gcggtgcgcgacgaaggcgcgggcgtcgtcgcgggcgagatcgatcccgcgcggatcgcc
gacgtgcggcagagcctgcccgcgtggcggcatcgcgtgctcgcgtga

DBGET integrated database retrieval system