KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3586Help
Entry
BURPS1106A_3586   CDS       T00480                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01130  Biosynthesis of antibiotics
bpl01230  Biosynthesis of amino acids
Module
bpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BURPS1106A_3586 (trpC)
Enzymes [BR:bpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BURPS1106A_3586 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABN92033
UniProt: A3NZP6
Position
I:3493835..3494620
Genome map
AA seq 261 aa AA seqDB search
MSDILDKIIAVKREEIAAALESAPLEELKVQASARDSRDFVGALRDKHAAGHAAVIAEVK
KASPSKGVLREHFVPADIARSYAQHGAACLSVLTDERFFQGSARYLEQARAACALPVLRK
DFIVDAYQVLEARAMGADAILLIAAALDTPLMIDLEAYAHSLGLAVLVEVHNRGELDEAL
KLKTPLVGINNRNLRTFETTIDTTLGMLDAIPDDRIVVTESGILSRADVERMEAAGVHTF
LVGEAFMRAENPGAELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcgacaaaatcatcgccgtcaagcgcgaagagatcgccgccgcgctc
gagagcgcgccgctcgaagaactgaaggtgcaggcgtcggcgcgcgattcgcgcgacttc
gtcggcgcgctgcgcgacaagcacgcggccggacacgccgccgtcatcgccgaggtgaag
aaggcgagcccgtcgaaaggcgtgctgcgcgagcatttcgtgccggccgacatcgcccgc
tcgtacgcgcagcacggcgccgcatgcctgtcggtgctgaccgacgagcggttcttccag
ggcagcgcgcgctatctcgaacaggcgcgcgccgcgtgcgccctgcccgtgctgcgcaag
gacttcatcgtcgacgcgtaccaggtgctcgaagcgcgcgcgatgggcgcggacgcgatc
ctgctgatcgccgcggcgctcgacacgccgctgatgatcgatctcgaggcgtacgcgcat
tcgctcgggctcgcggtgctcgtcgaagtgcacaaccgcggcgaactggacgaagcgttg
aaactgaagacgccgctcgtcggcatcaacaaccgcaacctgcgtacattcgagacgacg
atcgacacgacgctcggcatgctcgacgcgattccggacgatcggatcgtcgtcaccgaa
tccggcatcctgtcgcgcgcggacgtcgagcggatggaggcggcgggcgtgcatacgttc
ctcgtcggcgaagcgttcatgcgcgccgagaacccgggcgcggaactcgcgcggatgttc
ttctga

DBGET integrated database retrieval system