KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3660
Entry
BURPS1106A_3660   CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_3660
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_3660
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ABN92267
UniProt: A3NZX0
Position
I:complement(3563264..3563782)
AA seq 172 aa
MAKKESIQKRLQKVRPPRVQLTYEVERGDAIEIKELPFVVGVVGDLAGQSEIEQPKLRDR
KFVNIDRDNFDDVMKAIEPRATFQVENRLSEAGGKFAVDLKFRSINDFNPDEVVGQVEPL
RRLLEARSKLADLRNKLAGNDKLEDLLSEVLSNTQQLEALKKSADGGDKQGE
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcgaagaaagaaagcattcaaaagcgcttgcagaaagtgcggccgccccgcgtccag
ttgacgtacgaggtcgaacggggcgatgcgatcgagatcaaggagctgccgttcgtcgtc
ggggtcgtcggcgatctggcggggcagtccgaaatcgagcagccgaagctgcgcgatcgc
aagttcgtcaacatcgaccgcgacaacttcgatgacgtgatgaaggcgatcgagccgcgc
gcgacgttccaggtggagaaccgcctgagcgaggcgggcggcaagttcgcggtcgacctg
aagttccgctcgatcaacgatttcaatccggacgaagtcgtcgggcaggtcgagccgctg
cgccgcctgctcgaggcgcgctcgaagctcgcggacctgcgcaacaaactggccggcaac
gacaagctcgaagacctgctgagcgaagtgctgtcgaacacgcagcagctcgaagcgctg
aagaagagcgcggacggcggcgacaagcagggcgaatga

DBGET integrated database retrieval system