KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_3665Help
Entry
BURPS1106A_3665   CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1106A_3665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_3665
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_3665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ABN89617
UniProt: A3NZX5
Position
I:3566930..3567715
Genome map
AA seq 261 aa AA seqDB search
MSYAPSLFGGNTPPPAPQTASSTDAGFQARSLVDLLYDGFFMLFLLKNGREPNDASEFGT
RIQEFLSEFERGAKKLNIAADDVYAAKFAFCAAIDESVLSSPFKIRADWERRPLQLVLFG
EQLAGEKFYQYLEECRAQGAARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEI
ANMKGKRAPFAPHWPLPDQISHRLKREVPLWAIGAVFALVGLLAFVGLNTYLKDSTVRAL
APYSQVIKVGPESANLTISLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgcgccctccctcttcggcggcaacacgccgccccccgcgccgcaaacggct
tcgtcgaccgacgccggcttccaggcgcgctcgctcgtcgatctgctgtacgacggcttc
ttcatgctgttcctgctgaagaacggccgcgagccgaacgacgcgtcggaattcggcacg
cgcattcaggaattcctgagcgagttcgaacgcggcgcgaagaagctcaacatcgccgcc
gacgacgtctatgcggcgaagttcgcgttttgcgcggcgatcgacgaatcggtgctgtcg
tcgccgttcaagatccgcgcggactgggagcgccggccgttgcagctcgtgctgttcggc
gagcaactcgcgggcgagaagttctatcagtacctcgaagaatgccgcgcacagggcgcg
gcgcggctgcagtcgctcgaggtgttccatatgtgcctgctgctcggcttccagggcaag
tatctgctcgaagggccggaaaagctcgcgtatctgaccgcacggcttggcgacgagatc
gcgaacatgaagggcaagcgcgcaccgttcgcgccgcattggccgctgccggaccagatc
tcgcaccggctcaagcgcgaggtgccgctgtgggcgatcggagcggtgttcgcgctcgtc
gggctgctggcgttcgtcgggctgaatacgtatttgaaagacagcaccgtgcgggcgctc
gcgccttattcgcaagtcatcaaggtggggccggagtcggctaatttgacgatttcgttg
ccttga

DBGET integrated database retrieval system