KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0035Help
Entry
BURPS1106A_A0035  CDS       T00480                                 

Definition
(GenBank) translocator protein, LysE family
  KO
K06895  L-lysine exporter family protein LysE/ArgO
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpl02000]
    BURPS1106A_A0035
Transporters [BR:bpl02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BURPS1106A_A0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysE
Motif
Other DBs
NCBI-ProteinID: ABN93561
UniProt: A3P168
Position
II:complement(28605..29225)
Genome map
AA seq 206 aa AA seqDB search
MNWIAFSHGAMLCASLIVTIGAQNAFILRQGIMRSHVGKIVLLCTLSDMLLIGAGVGGAS
VLVERYPAFVHAVLYVGLAYLAWFGLSALRRAFKPGHETLDATGAVAAPPAQRAWPIVLM
TLAFTWLNPHVYLDTFLLIGTAGAREPEGARGAFAIGAMAVSAVWFVALGYGARLLAPWF
KRALAWRVLDGAIGGMVLFLAAVQLR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaactggatcgctttttctcacggcgcgatgctctgcgcatcgctcatcgtcaccatc
ggcgcgcagaatgcgttcatcctccggcagggcatcatgcgttcgcacgtcggcaagatc
gtcctgctctgcacgctgtcggacatgctgctgatcggcgcgggcgtcggcggcgcatcg
gtgctcgtcgagcgctatccggctttcgttcatgccgtgctgtatgtcggcctcgcctat
ctcgcatggttcggcctgagcgcgctgcgccgcgcgttcaagcccggccacgaaacgctc
gatgcgacgggcgcggttgccgcgccgcccgcgcagcgcgcctggccgatcgtgctgatg
acgctcgcgttcacatggctcaacccgcacgtctatctggacacgttcctgctgatcggc
acggccggcgcgcgcgagccggaaggcgcgcgcggcgcgttcgcgatcggcgcgatggcg
gtcagcgcggtatggttcgtcgcgctcggatacggcgcgcgattgctcgcgccatggttc
aagcgcgcgctcgcgtggcgcgtgctcgacggcgcgatcggcggcatggtgctgtttctc
gcggcggtgcagttgcgctaa

DBGET integrated database retrieval system