KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0140Help
Entry
BURPS1106A_A0140  CDS       T00480                                 

Definition
(GenBank) ImcF/SciS family protein
  KO
K11891  type VI secretion system protein ImpL
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1106A_A0140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_A0140
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_A0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: ABN95163
UniProt: A3P1H3
Position
II:123803..127711
Genome map
AA seq 1302 aa AA seqDB search
MSYLKRFLRFVFSWQMLACIAVLLVCAAVWFVGPLLAFDELRPLAGVVVRVAVIVLLVAL
LAFWLLRWPLSPIGVAALCLLIWHAGPLFAFGDHRPFGPAWVRVLIVAAMLFCYAVYGLY
RLWQAVRTNDALLKRILEPSAGKPDAAAQANIRAVSVAVSKAIGQLKRLRGGAFGWRRLL
ESGRYLYELPWYMVVGAPGAGKSAAIARSGLKFPLADQMEASSERARGGTANCEWWFANE
AVLIDTAGRYVRHEVPGDEEATVANGAEWKGFLGLLRKHRPRAPVNGVVLSVSVEELVGR
TPAERTAHAATLRARLGELHQELGIHFPVYVIVTKLDLLPGFPEYFQSLTAEGRTQIWGF
TLPYDAENRRSAVGALREHCADELKRLEMRIDAGLNNRLLEEYENDRRKRLYALPQEFRS
LSAALSDMLALVFLDSRYDDAQLQNTLRGVYFTSAEQTDQVLAADRETILQRLKRQLGRM
LGGDAGAQTRDSGAVSGSRGYFLRDVFQHVIVPEAHLVRPNVRWEVRFRLMRWAGHLLAV
ALLVWLASALTVSFDNNRGYLDAISEKTAALAARVNAYNKAPKPAQIGGVLDGARDLPQH
GNLDLDAPGASFRYGLYVAPGIVDASDATYRSLLRRSLLPQIVRRVEDALSAQIDAKHAD
EVYRTLTVYLMLDDAARHDAKAVKDWVMRDWERSDSAAEMGGRNLMARHLDALFVDARPF
EPSGHRNAALVQRARLFLNANPAPRRLYERAMAAIEKEAPENFTLARAVGLQGAGIFRLA
DGSRFQRGMPGLYTYDGYHQVFSARLPEFLARAQSDDAWVMGNAGPAARWGDAIRNTQAV
AGRSSLADDIRRQYLTDYGNYWQQYLADIRPASSGEDGAGGTLAFDLATLRALAAPDSPL
VRLARAVVRETSLSVVDAREDASLTDAALSSLGRRSGAAKEVADGAQKLAARRPEQRLEK
ELVDNRFAALREVVTGQADTGSGPAMTDVPVAAGGRALQLDAILTLINEQYTRLVVADNA
LSSQSMPPALDIGTTLQMEAEKLPAPLRTVLGGIATQAADKVGREVGSLLAMQVDSSVGN
ACRAAVDGKYPFARSAQEVDIEDFNRLFAAGGLFDAFFQKALAPHVDTHSKPWRYKALNP
GMPPIRGPSLEPFERAAAIRDVFFREPGAKRMAWRMDAKVASIDPEITELIVDVDGQSQR
YVHGPVLPFSVNWPGPRGGAIAEITAKPRIRPDTSTIATTGPWALFRLIERGRLTGTTSA
SRLMLDFDFDGRHAALELRTNGQMNPLTSGLLTHFRCPGSVG
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacctgaaacgcttcttgagattcgtcttttcgtggcagatgctcgcatgcatc
gcggtgctgcttgtttgcgccgccgtatggttcgtcggccccctgctcgcgttcgacgag
ttgcggccgctcgcgggcgtcgtcgtgcgggtcgccgtcatcgtccttctcgtggcgctc
cttgcgttctggctgttgcgctggccgctcagcccgatcggcgtcgccgcactgtgtctg
ctgatctggcacgcggggccgctcttcgcgttcggcgatcaccgcccgttcgggcccgcg
tgggtccgcgtgctgatcgtcgccgcgatgctcttctgctacgccgtgtatggtctctat
cgcctgtggcaggcggttcggacgaacgacgcattgctcaagcgcattctcgagccgtcg
gcgggcaagccggacgcggcggcccaggcgaacatccgtgcggtgagcgtggcggtgtcg
aaggcgatcggtcaactgaagcgcttgcgcggcggtgcgttcggctggcggcgcttgctc
gaaagcgggcgctacctgtatgaactgccgtggtacatggtggtcggcgcgcctggtgcg
ggcaagagcgcggcgatcgcgcgttccggcctgaagtttccgctcgcggatcagatggag
gcatcgtccgagcgcgcgcggggcggcacggccaattgcgaatggtggttcgccaacgag
gccgtgttgatcgacacggcgggccgttacgtgcggcacgaggtgcccggcgacgaagag
gcgacagttgccaacggggcggagtggaagggctttctcggtctgcttcgcaaacatcgg
ccgcgcgcgccggtcaatggcgtggtcctgtcggtcagcgtcgaggagctcgtcgggcgc
acgccggccgagcgcaccgcgcacgcagccacgctgcgcgcccgcctgggcgagttgcat
caggaactgggcattcatttcccggtatacgtgatcgtcacgaaactcgatttgctgccc
ggctttccggagtatttccagtcgttgacggccgaagggcggacgcagatctggggattc
acgctgccctacgacgcggagaacaggcggagcgcggtcggcgcgctgcgcgagcattgc
gccgacgagctgaagcggctggagatgcgtatcgacgcggggctgaacaaccgtctgctc
gaagagtacgaaaacgatcgccgcaagcggctgtatgcgttgccgcaggagttccggagc
ctgtcggccgcgctgtcggacatgctcgccctcgtgtttctcgattcacgctacgacgac
gcccagttgcagaacacgctgcgcggcgtctacttcacgagcgccgagcagacggatcag
gtattggccgcggatcgcgaaaccatcctgcagcgcttgaagcgccaactcggcagaatg
ctcggcggcgatgccggcgcgcagacgcgtgacagcggcgcggtgtcgggcagccgcggc
tacttcctgcgcgatgtgttccagcatgtgatcgtgccggaggcgcatctggttcggccg
aacgtcaggtgggaggtgcgttttcgcctgatgcgctgggccgggcatctgctcgccgtc
gcattgctggtctggctggcgagcgcgctgacggtgagcttcgacaacaatcgcggttac
ctggacgcgatctcggaaaagacagccgcgctcgccgcacgagtcaacgcgtacaacaag
gcgccgaagccggcgcagatcgggggcgtactggatggcgcgcgcgatcttcctcagcat
ggcaatctcgatctcgacgcgcccggcgcgagcttccgctacggcctgtatgtcgcaccc
ggcatcgtcgacgcgtccgacgcgacttatcggagcctgctgcgccggagccttctgccg
cagatcgtgcggcgcgtcgaagatgcactgagcgcgcaaatcgatgcgaagcatgcggac
gaggtctatcgcacgctgacggtctacttgatgctcgacgacgccgcgcgccatgacgcg
aaggcggtgaaagactgggtcatgcgcgactgggagcgctcggatagcgcggccgagatg
ggggggcgcaatttgatggcgcggcacctggacgcgctgttcgtcgatgctcggcctttc
gagccgagcgggcaccggaacgccgcactcgttcagcgcgcccggcttttcctcaacgcg
aacccggccccgaggcggctgtacgagcgtgcgatggccgcgatcgagaaggaggcgccg
gagaacttcacgctcgcgcgtgcggtcgggcttcagggcgcgggcatctttcggctcgcc
gacggctcgcggtttcaacgcgggatgcccggcttgtatacgtacgatggctaccaccag
gtattcagcgcccggttgcccgaatttctcgcccgtgcgcaaagcgacgacgcatgggtg
atggggaacgccggccccgccgcgcgatggggcgacgcgattcggaacacgcaggccgtt
gcgggtcggtcttcgcttgccgacgacattcgtcgccagtacctgacggattacggcaac
tattggcaacagtatctggcggacattcggcccgcgtcgtccggagaggacggcgcgggc
ggcacgctcgcattcgatctcgcgacgctgcgcgcgctcgccgcccccgattcaccgctc
gtgagactggcgcgcgccgtcgttcgcgaaacatcgctgtcggtcgtcgacgcacgggaa
gacgcgtcgttgaccgacgccgcgctttcgtcgctcgggcgacgatccggcgcggcgaag
gaggttgccgacggcgcgcagaaactggcggcgcggcggccggagcagcgcctcgagaag
gagctggtggacaaccgcttcgcggcgctgcgcgaggtggtgacggggcaggccgacacg
ggaagcgggccggcgatgacggacgtgccggtcgcggcggggggccgggcgctgcagctc
gacgcgatcctcacgctgatcaacgaacagtacacgcgcctcgtcgttgccgacaacgcg
ctctcctcgcagagcatgccgcccgcgctggacatcggcaccaccttgcaaatggaggcg
gagaaactgcccgcgccgctgcgcacggtgctgggcggcatcgcgacgcaagccgccgac
aaagtcgggcgcgaagtgggttcgctgctcgcgatgcaggtggactcgagtgtcggcaac
gcgtgtcgcgccgccgtcgacggcaagtatccgttcgcgcgcagcgcgcaggaagtcgac
atcgaggatttcaaccgcctcttcgccgcgggcggcctgttcgacgcgttttttcagaag
gcgctcgcgccgcatgtcgacacccattcgaagccgtggcgttacaaggcgttgaatccc
ggcatgccgccgatccgggggccgagcctcgagccgttcgagcgcgccgccgcgattcgc
gacgtgttctttcgtgaaccgggcgcaaagcggatggcgtggaggatggatgcgaaggtg
gcgtcgatcgaccctgagatcaccgagctcatcgtcgacgtcgacggccagtcgcagcgc
tatgtccacggccccgtgctgccgttctccgtgaactggcccgggccgcgcggcggcgcg
atcgccgagatcaccgcgaagccgcggattcgtcccgatacgtcgacgatcgcgacgacg
gggccctgggcgctgtttcggctgatcgagcgcgggcggttgacgggcaccacgtcggcg
agccggttgatgctggatttcgatttcgacggtcggcacgctgccctggagctcaggacg
aacggccagatgaatccgttgacgagcggcttgctgacgcattttcgctgtccggggagc
gtcggttga

DBGET integrated database retrieval system