KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0247
Entry
BURPS1106A_A0247  CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_A0247
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_A0247
SSDB
Motif
Pfam: GPW_gp25 Sensor
Other DBs
NCBI-ProteinID: ABN94556
UniProt: A3P1T0
Position
II:236500..237081
AA seq 193 aa
MDAHETRADAPRNGDEARVRGEGLATPRRANTQLLPTLIDRLRDDAPQRQTEAPGEYALT
RMQMRGIVQRDLAFLLNTTSIDEHIDRERHPAAAASTLNFGVPPLAGAFLASCQWAEVER
IIRRVILDFEPRLIAETLVVAPSRAAGAVARPNVLAFEVRGMIRMDPYPIEFMVQSALDL
ETNQVNITGMRAS
NT seq 582 nt   +upstreamnt  +downstreamnt
atggatgcgcatgagacgcgcgcggacgcgccgcgcaacggcgacgaggcgcgcgtgcgc
ggcgaaggcctcgcgacgccgcgccgcgcgaacacgcagctgctgccgacgctgatcgac
cgcctgcgcgacgacgcgccgcaacggcagaccgaagcgcccggcgaatatgcgctcacg
cgcatgcagatgcgcggcatcgtccagcgtgatctcgccttcctgctcaacacgacgagc
atcgacgagcacatcgatcgcgaacgccatccggccgccgccgcctcgacgctcaacttc
ggcgtgccgccgcttgccggcgcgtttctcgcgtcgtgccagtgggccgaggtcgaacgc
atcatccgccgcgtaattctcgatttcgagccgcggctgatcgccgagacgctcgtcgtc
gcgccgtcgcgggccgccggcgcggtcgcgcgcccgaacgtgctcgcgttcgaggtgcgc
ggcatgattcgtatggatccctatccgatcgaattcatggtgcaaagcgcgctcgatctc
gaaacgaaccaggtcaacatcaccggcatgcgcgcgagctga

DBGET integrated database retrieval system