KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0249
Entry
BURPS1106A_A0249  CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11895  type VI secretion system protein ImpH
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_A0249
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_A0249
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABN92746
UniProt: A3P1T2
Position
II:239001..240086
AA seq 361 aa
MARDMTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARIDPIGKARRPQAEPFR
LGQQPSLAFAPREIASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIARDREESRRDPTL
GNFLDIFHHRYLTLLYRAWASAQAAAGLDRPDDERFSFYVASLAGQDLDEVGARPLPAHA
RLSASPHLVREARNADGLRMTLERYFGVPVTLEENVFHWIAVDPLEHSRLGRPGDASTMA
AGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPRLVEWVRAFVGYEFEWELELR
IKPNGAPPAVMGGPHQLGWSGWLGRSPSGEPVTGMRFEPEHYAHGFARGTARDTRGMRGE
R
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggcgcgcgacatgacgcaggcggccgttgccgacacggcgctgtcgccgcaagcgctc
gcgcggctgcgcgccgaaccgtggcgctatgggttcctcgcgctgctgcgccgcatcggc
gcggatgcgcgcatcgatccgatcggcaaggcgaggcgcccgcaggcggagccgtttcgc
ctcggccagcagccgagcctcgcgttcgcgccgcgcgagatcgccagcgtcggcgacgcg
aacgggcggctcaaggtgcggctgttcgggctcgggatgctggggccgaacgggccgctg
ccgatccacgtgacggagatcgcgcgcgatcgcgaggagagccggcgcgatccgacgctc
ggcaattttctcgacatcttccatcatcgctatctgacgctgctgtatcgcgcgtgggcg
tcggcgcaggcggcggccggcctcgatcgtccggacgacgaacggttttcgttctacgtc
gcgagcctcgccggccaggatctcgacgaggtcggcgcgcggccgctgcccgcgcacgcg
cggctgtccgcctcgccgcatctggtgcgcgaggcgcgcaacgcggacggcctgcgaatg
acgctcgaacgttacttcggcgtgccggtgacgctggaggaaaacgtatttcactggatc
gccgtcgatccgctcgagcacagccggctcggccggcccggcgacgcatcgacgatggcc
gcgggcgcgctgctcggcgagctggtgccggatcggcagcacaagttccggctcgtgttc
gggccgctcgacatcgacgcctatctgcgcttcacgccgcggggcgaggatctgccgcgg
ctcgtcgaatgggtgcgggcgttcgtcggctacgagttcgagtgggagctcgagttgcgg
atcaagccgaacggcgcgccgcccgccgtgatgggcggcccgcatcaactcggctggtcg
ggctggctcggccgctcgccgtccggcgagccggtgacgggcatgcgtttcgaacccgag
cactatgcgcacgggttcgcgcgcggcacggctcgcgacacgcgcggcatgcgaggtgaa
cgatga

DBGET integrated database retrieval system