KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0405Help
Entry
BURPS1106A_A0405  CDS       T00480                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00450  Selenocompound metabolism
bpl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BURPS1106A_A0405 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bpl03016]
    BURPS1106A_A0405 (selD)
Enzymes [BR:bpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     BURPS1106A_A0405 (selD)
Transfer RNA biogenesis [BR:bpl03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    BURPS1106A_A0405 (selD)
 Prokaryotic type
    BURPS1106A_A0405 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ABN95506
UniProt: A3P288
Position
II:383823..384980
Genome map
AA seq 385 aa AA seqDB search
MYRCRSGHGGSRAIARRIVDNRAFYPLSDLAMTETKQTDAAALRLTSLSHGGGCGCKIAP
GVLSELLRRTAPPALFPDLLVGTETSDDAAVYRLNDEQAIVATTDFFMPIVDDPFDFGRI
AATNALSDVYAMGGKPILALALVGMPINVLPHETIAAVLRGGEAVCADAGIPVAGGHSID
SVEPIYGLAALGVVHPARVKRNAAARAGDVLVLGKPLGVGVLSAALKKDRLDAQGYAQMI
ATTTKLNRPGTALAALPGVHALTDVTGFGLLGHTLELARGAGLTARVRYGALPWLAGVEA
LVADGVLTGASGRNWAAYGHDVRLGDGLPAVAQALLTDPQTSGGLLVACAPEAVDDVLAC
FRDDGFERAAAIGEMVDGAARVDVS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccgctgccgaagcgggcacggcggctcgcgcgcaatcgcgcgccggattgtcgat
aatagagcgttctatcctctatcggatttggcgatgaccgagaccaagcaaaccgacgcg
gcggcgctgcgcctcacgagcctgtcgcacggcggcggctgcggctgcaagatcgcgccc
ggcgtgctgtcggagctgctccggcgcaccgcgccgccggcgctctttcccgatctgctc
gtcggcaccgagacgtccgacgacgcggccgtctatcgtctgaacgacgagcaggcgatc
gtcgcgaccaccgatttcttcatgccgatcgtcgacgatccgttcgacttcgggcggatc
gccgcgacgaacgcgctgtccgacgtctacgcgatgggcggcaagccgatcctcgcgctc
gcgctcgtcggcatgccgatcaacgtgctgccgcacgaaacgatcgccgcggtgctgcgc
ggcggcgaggcggtgtgcgcggacgcgggcattcccgtcgcgggcggccattcgatcgat
tcggtcgagccgatctacgggctcgcggcgctcggcgtcgtccatccggcgcgcgtgaag
cgcaatgcggccgcgcgcgcgggcgacgtgctcgtgctcggcaagccgctcggcgtcggc
gtgctgtccgccgcgctgaagaaggaccggctcgatgcgcaaggctacgcgcaaatgatc
gcgacgacgacgaagctcaaccggccgggcacggcgctcgccgcgctgccgggcgtgcac
gcgctgaccgacgtgacgggcttcggcctgctcggccatacgctcgagctcgcgcgcggc
gcggggttgaccgcgcgcgtgcgttacggtgcgctgccatggctcgcgggcgtcgaggcg
ctcgtcgccgacggcgtgctgaccggcgcgtccgggcgcaactgggccgcgtacggtcac
gacgtgcggctcggcgacgggctgcccgccgtcgcgcaggcgctgctgaccgatccgcag
acctcgggcgggctgctcgtcgcatgcgcgccggaagcggtcgacgacgtgctggcctgc
ttccgcgacgacggcttcgagcgtgcggcggcgatcggcgaaatggtcgacggggcggcg
cgggtcgatgtgagctga

DBGET integrated database retrieval system