KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0691Help
Entry
BURPS1106A_A0691  CDS       T00480                                 

Gene name
pepM
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00440  Phosphonate and phosphinate metabolism
bpl01100  Metabolic pathways
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BURPS1106A_A0691 (pepM)
Enzymes [BR:bpl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BURPS1106A_A0691 (pepM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD L27
Motif
Other DBs
NCBI-ProteinID: ABN94958
UniProt: A3P317
Position
II:complement(674614..676302)
Genome map
AA seq 562 aa AA seqDB search
MNAREPNFTESRSARLRRMLTSPSLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAQAGADAILIHSKLSRPDEILQFAREWSGRAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQAVAREIQDSETLVNVEERVASVNEIFRLQDADEYSAAERIYLSSS
ARASSAALVLAASRGNGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGGYR
ADAIDTSGVKLVVNERHAQTGELASLACAAERLTGDTIISYGDLLFRSYILRDLAESEAQ
FSVVVDSSQTQPSNQSVRDFAFCSAADDRGLFGQKAYLRRVSSDASEAAPHGRWIGLLNV
RGAGVARLKAMLGTLQARDDFDALDLPALLNALVDAGEQIEVQYVHGHWRGVNDLDDFRR
AGDFAHGQTPYAEQNAGSGSAR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacgcgaaccgaacttcaccgaatcgcgcagcgcgcggctgcggcggatgctg
acgagcccgtcgctcgaattcctgatggaggcgcacaacggcctgtccgcgcgcatcgtc
cgcgaggcgggcttcaagggcatctgggcgtcggggctcgcgatctccgcgcaattcggc
gtgcgcgacaacaacgaggcgagctggacacaggtggtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccggctcgtgagaaagctcgagcagcgcggcatcgccggcgtgtgcatcgaggac
aagcagtttccgaaaaccaacagcttcatcgacggcgagcgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagagcgatccggatttctcg
atcgtcgcgcgcgtcgaggcgctgatcgccggctggggcatggacgaggcgctgcgccgc
gcgaacgcgtatgcgcaggccggcgccgatgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgagaatggagcggccgcgcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggcgggcatcagcaccgtg
atctgggcgaaccatctgatccgcgcgtccgcttccgcgatgcaggcggtcgcccgcgaa
atccaggacagcgaaacgctcgtcaacgtcgaggaacgcgtggcgagcgtcaacgagatc
ttccggctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcgtcgagc
gcgcgcgcgtcgagcgcggcgctcgtgctcgccgcgagccgcggcaacgggctcgaggcc
gtcaccgaggacaagccgaaggtgatgctgccggtcgccggcaagccgctgttgcgctgg
ctcgtcgacggcttcaagaagcagggcgtgaacgacatcacggtcgtcggcggctaccgc
gccgatgcgatcgacacgtccggcgtgaagctcgtcgtcaacgagcggcacgcgcaaacg
ggcgagctcgcgtcgctcgcctgcgcggccgagcgtctgacgggcgacaccatcatctcg
tacggcgatctgctgtttcgcagctacatcctgcgcgacctcgcggaaagcgaggcgcag
ttcagcgtcgtcgtcgattcgtcgcagacgcagccgtcgaaccagagcgtgcgcgatttc
gcattctgctcggccgccgacgaccgcgggctgttcggccagaaagcgtacctgcgccgc
gtgtcgagcgacgcgagcgaggccgcgccgcacgggcgctggatcggcctgctgaacgtg
cgcggcgcgggcgtcgcgcggctgaaggcgatgctcggtacgctccaggcgcgcgacgat
ttcgatgcgctcgacctgccggcgctgctgaacgcgctcgtcgacgcgggcgagcagatc
gaagtgcagtacgtgcacggccattggcgcggcgtcaacgatctcgacgacttccgccgc
gcgggcgacttcgcgcacggccagacgccgtacgcggagcagaacgcgggcagcgggagc
gcacgatga

DBGET integrated database retrieval system