KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0696Help
Entry
BURPS1106A_A0696  CDS       T00480                                 

Definition
(GenBank) acetyl-CoA hydrolase/transferase family protein
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00020  Citrate cycle (TCA cycle)
bpl00620  Pyruvate metabolism
bpl00650  Butanoate metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
bpl01200  Carbon metabolism
Module
bpl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BURPS1106A_A0696
   00620 Pyruvate metabolism
    BURPS1106A_A0696
   00650 Butanoate metabolism
    BURPS1106A_A0696
Enzymes [BR:bpl01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BURPS1106A_A0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABN94524
UniProt: A3P322
Position
II:679927..681441
Genome map
AA seq 504 aa AA seqDB search
MPTSRILAPSLRSLVRTADEAAALIGPNMTVAMSGFTGSGYPKAVPAALAARIAASHARG
EDFRINVLTGASTAPELDGALAKADGISMRLPYQSDPTLREKINAGELDYQDIHLSHVAQ
YAWFGLFGELDVAIVEVAGIREDGRLIPSASVGNNKTWLDQAKRVILEVNARQPLGLDGM
HDIYYGTALPPNRKPIPLVKSDDRIGEPYLRCPAEKIVAIVETDAPDRSNAFAAPDETSK
QIAGLLIDFLRHEIKRGRLPEHLLPLQSGVGNITNAVLAGLGEGGFSNLSAYTEVIQDGM
LDLLANGTLSFASATALSLSPDAVKRFADEIDTFRSKIVLRPQEISNHPELVRRLGIIAM
NGMIEADIYGNVNSTHVMGTRIQNGIGGSGDFARNGYLSCFMSASTAKGGAISRIVPMAS
HVDHTEHDVAVVVTEQGLADLRGLSPKQRARKVIANCAHPDYRPMLEDYFERASRESFGK
QTPHLLGEALSWHERYVRTGSMKA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgccaacctctcgtatcctcgcccccagcctgcgctccctcgttcgcaccgccgacgag
gccgccgcgctgatcggcccgaacatgaccgtcgcgatgagcggcttcaccggctccggc
tatccgaaggcggtgccggccgcgctcgccgcgcggatcgcggcttcccacgcgcgcggc
gaagatttccgcatcaacgtgctgacgggcgcgtcgaccgcgcccgagctggacggcgcg
ctcgcgaaggcggacggtatctcgatgcggctgccgtaccagtccgatccgacgctgcgc
gagaagatcaacgcgggcgagctcgactatcaggacatccacctgagccacgtcgcgcag
tacgcgtggttcggcctgttcggcgagctggacgtcgcgatcgtcgaggtcgcgggcatt
cgcgaggacgggcgcctgattccgtcggcgtcggtcggcaacaacaagacgtggctcgac
caggccaagcgcgtgatcctcgaggtgaacgcgcgccagccgctcggtctcgacgggatg
cacgacatctattacggcaccgcgctgccgccgaaccgcaagccgattccgctcgtgaag
agcgacgaccggatcggcgagccgtatctgcgctgcccggccgagaagatcgtcgcgatc
gtcgagaccgacgcgccggaccgcagcaacgcgttcgccgcgccggacgagacctccaag
cagatcgccggactcctgatcgatttcctgcgtcacgagatcaagcgcggccgtctgccc
gaacacctgctgccgctgcagtccggcgtcggcaacatcacgaacgcggtgctcgccggc
ctcggcgaaggcggtttctcgaacctgagcgcgtatacggaagtgattcaggacggcatg
ctcgatctgctcgcgaacggtacgctgagcttcgcgtcggcgaccgcgctgtcgctcagc
ccggatgcggtgaagcgcttcgccgacgagatcgatacgttccgctcgaagatcgtgctg
cggccgcaggaaatcagcaaccatccggagctcgtgcggcgcctgggcatcatcgcgatg
aacgggatgatcgaggccgatatctacggcaacgtgaactcgacgcacgtgatgggcacg
aggattcagaacgggatcggcggctccggcgatttcgcgcgcaacggctatctgtcgtgc
ttcatgtcggcgagtaccgccaagggcggcgcgatttcgcggatcgtgccgatggcgagc
cacgttgaccataccgagcacgacgtcgcggtcgtcgtgaccgagcaggggctcgcggat
ctgcgtggactgtcgccgaagcagcgcgcgcgcaaggtcatcgcgaactgcgcgcatccc
gattaccggccgatgctcgaagactacttcgagcgcgcgagccgcgagagcttcggcaag
cagacgccgcatctgctcggcgaagcgctgtcgtggcacgagcgctacgtgcggaccgga
tcgatgaaagcctga

DBGET integrated database retrieval system