KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0702Help
Entry
BURPS1106A_A0702  CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1106A_A0702
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_A0702
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_A0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ABN93840
UniProt: A3P328
Position
II:686334..686861
Genome map
AA seq 175 aa AA seqDB search
MANALVDYFLQIDGVEGESTDQQYPGLIQIQSWQWAEENSGRWGFGSGGGAGKVEMKDFE
FRMVSNKASPKLFLMCATGEHIQNAKLICRKSGKGQQEFLTISFASGLVSSFRTLGNMPI
SQLGHASGEVDGVLPTDQIRINFAQIEFEYREQRNDGTMGAVIKAGYDLKQNAPI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgctttggttgattacttcttgcagatcgatggcgtcgagggtgagtcgacc
gatcagcaatatcccggtctgatccagatccagagctggcagtgggcggaagagaactcg
ggccgctggggcttcggcagcggcggcggcgcgggcaaggtcgagatgaaggacttcgag
ttccgcatggtgtcgaacaaggcgtcgccgaagctgttcctgatgtgcgcgacgggtgag
cacatccagaacgcgaagctgatctgccgcaagtcgggcaagggccagcaggagttcctg
acgatctcgttcgcgagcggcctcgtgtcgtcgttccgcacgctcggcaacatgccgatc
tcgcagctcggtcacgcgagcggcgaagtcgacggcgtgctgccgacggatcagatccgc
atcaacttcgcccagatcgagttcgagtaccgcgagcagcgcaacgacggcacgatgggc
gccgtgatcaaggcgggctacgacctgaagcagaacgcgccgatctaa

DBGET integrated database retrieval system