KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A1918Help
Entry
BURPS1106A_A1918  CDS       T00480                                 

Definition
(GenBank) HAD hydrolase, family IA
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00010  Glycolysis / Gluconeogenesis
bpl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1106A_A1918
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     BURPS1106A_A1918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ABN92973
UniProt: A3P6J2
Position
II:complement(1878493..1879146)
Genome map
AA seq 217 aa AA seqDB search
MRRLPGASREAERMTQPIKLVLFDMEGVLSDYDRAARTARLADLTGRPPEAVRHAIWESG
LEARADAGRIGVDQYLRELAQLLGAPVSRDDWLIARKASITPNLEVVALAERVARCSRIA
VLTNNCRLVTDYIDYLNPPVARVFGAHVYPSATFGAAKPDAQAYLGCVGWLGVTAQETLF
IDDADANVAGAVSAGLLGCKFVGAGALAQELARRRLA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcgcttgccgggcgcttcacgcgaggccgagcgcatgacgcagccgatcaagctg
gtgctgttcgacatggagggcgtgctgtcggattacgaccgcgccgcgcgcaccgcgcgc
ctggccgacctgacggggcggccgcccgaggcggtgcgtcacgcgatctgggagtcgggg
ctcgaagcgcgcgccgacgcggggcgcatcggcgtcgaccaatacctgcgcgagctggcg
caattgctcggcgcgccggtgagccgcgacgattggctgatcgcgcgcaaggcgtcgatc
acgccgaatctggaggtcgtcgcgctggcggagcgcgtcgcgcggtgcagccggatcgcg
gtgctgacgaacaattgtcggctcgtcaccgattacatcgattatctgaatccgcccgtt
gcgcgcgtgttcggtgcgcacgtctatccgtccgcgacgttcggcgcggcgaagccggac
gcgcaggcttacctcggctgcgtcggctggctcggcgtgacggcacaggagacgcttttc
atcgacgacgccgatgcgaacgtcgcgggcgcggtgagcgcggggctgctcggatgcaag
ttcgtgggcgcgggcgccttggcgcaagagctggcgcggcggcggctcgcgtag

DBGET integrated database retrieval system