KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2027
Entry
BURPS1106A_A2027  CDS       T00480                                 

Definition
(GenBank) hcp protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1106A_A2027
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_A2027
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_A2027
SSDB
Motif
Pfam: T6SS_HCP THP2
Other DBs
NCBI-ProteinID: ABN94557
UniProt: A3P6V0
Structure
PDB: 
3WX6

Position
II:1995159..1995668
AA seq 169 aa
MLAGIYLKVKGKTQGEIKGSVVQEGHDGKIHILAFKNDYDMPARLQEGLTPAAAARGTIT
LTKEMDRSSPQFLQALGKREMMEEFEITIHRPKTDTTGGDLTELLFTYKFEKVLITHMDQ
YSPTPHKDDSNGIKEGLLGYIEEIKFTYSGYSLEHAESGIAGAANWTNG
NT seq 510 nt   +upstreamnt  +downstreamnt
atgctggccggaatatatctcaaggtcaaaggaaaaacccagggggaaatcaaaggctcc
gtcgttcaggaaggtcatgacgggaaaatccacatcctcgccttcaagaacgactacgac
atgcctgccaggctccaggaaggcctgacgcccgccgccgccgctcgcggcacgatcacg
ttgacgaaggaaatggacagatcgtcgccgcaattcctgcaggcgctcggcaagcgcgag
atgatggaagagttcgagatcacgatccaccgtccgaagacggatacaacaggtggggac
ctgaccgaactcctgttcacgtacaagttcgaaaaagtgctgatcacccacatggaccaa
tactcgcccacgccgcacaaagacgatagcaacggcatcaaggaaggcttgctcggctat
atcgaggagatcaagttcacgtattcgggatactcgttggaacacgcggaatcgggcatc
gcgggcgccgcaaactggacgaatggctga

DBGET integrated database retrieval system