KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2032
Entry
BURPS1106A_A2032  CDS       T00480                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BURPS1106A_A2032
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_A2032
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_A2032
SSDB
Motif
Pfam: Phage_GPD Phage_base_V LmeA
Other DBs
NCBI-ProteinID: ABN94456
UniProt: A3P6V5
Position
II:2001981..2005004
AA seq 1007 aa
MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVS
RQLRIDFAKMLSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWR
LSLYKASDVYLNEQTIPDIVKRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVS
RWMEKEGLYYYFEHDGRHETLVIVDDRRHQPGPADDLALRYRPATSLDAGIEADRVQAFT
CRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVSSDEHFHTKDEGRRYAKLRAE
ALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLVTALTHRGSQAHLLFPDLDAP
FGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYK
VRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAV
PNSSHRSVVTRRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLT
SGNKFDFSLGNAYSFSGGLKCSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGS
RSFEINDSASTLLQTLHKQSATGAIRLSAGQDASALLQKQLDKLKGTVRKFMIVSGLANA
GSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGATGVSTALMATSRTLLANVAKLQEALP
LVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSVGKGRWGVEAA
KHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQN
TFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSA
VRMSASDAQLGFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAA
GCGSASLKLGSDGAIDVSATDVKLNGTNVKLNGSASLKFDGQLIQLG
NT seq 3024 nt   +upstreamnt  +downstreamnt
atgccttcgtccccccgccacgatgcgcccgcgtcgcgcgcgaacgccgcgccgtccgcg
aacgcgcgacgcttcacgttcgcgagcgacgcgtacgaccccgcgacgttcgacgtcgtc
gacatcaacggccgcgacgcgatctcgcagccgtaccggttcgagatcacgctcgtgagc
aggcagttgcggatcgacttcgcgaagatgctgagccgcggggcgacgctcgcgatcctg
ccgccgttcggcgaggccggcaccacccgctatgccggcgtgctcgccgaattcgagcag
aagaagcgctttcgcgacttcaccgtctatcgcgcgacgctcgtgccgcgcctctggcga
ctatcgctgtacaaggcgtcggacgtctatctgaacgagcagacgattcccgacatcgtc
aagcgcgtgctgcgcgccgcctcgttcggcagccgcgatttccgcatgcggcacggcggc
ggctaccgcaagcgcagcttcgtctgccagtacgacgagagccatctcgatttcgtgtcg
cgctggatggagaaggaaggcctctactactacttcgagcatgacggccggcacgaaacg
ctcgtgatcgtcgacgaccgccgccatcagcccggccccgccgacgatctcgcgctgcgc
taccgacccgcgaccagcctcgacgcgggcatcgaagcggaccgcgtgcaggcgttcaca
tgccgggcgacgccgctgccgcgcgaagtcgtgctgcgcgatttcaaccaccgcaaggcg
gagctctcgctcgaagtccgcgagcgcgtggcgcgcgacggcgtcggcgagcgggtgtcg
agcgacgagcacttccacacgaaggacgaagggcggcgctacgcgaagctgcgcgccgag
gcgctcgtctgcgaagggcgccgattcgccggcgaatcgaccgctgccgggctgcgcgcc
ggccgcttcttcgcgctgtcgggccactaccgcgaggatttcgacggccgctatctggtg
acggcgctcacgcatcgcggctcgcaggcacacctgctgtttcccgatctcgacgcgccg
ttcggcgcgacgccgggcgagcccatctaccgcgccgagttcgaggcgattgccgccgac
ctccagtaccggccgccgcgcacgacgcccaagccgcgcgcggcgggcgtcgtcagcgcg
atcgtcgacggcgagggcggcggcaagctcgccgagctcgacgaatacggccagtacaag
gtgcgctttccgttcgcgcacaccgcgcatccggcgaacaaggcctccgcgcgcatccgg
atggcgacgccctacgcgggcgacgaccgcggcatgcacctgccgctgctgaagcgcacc
gaagtgaagatcgcattcgacggcggcgatccggaccgccccgtgatcgtcggcgcggtg
cccaactcgtcgcaccgcagcgtcgtcacgcgccgcaaccccgccgagcatcgcatcctc
accgagcacaaccagctctacatgaaggacggcagcggcgcggcgacgtggctgcacgcg
ccgaacaaccacatcggcatcggcgcggtcgggccgggcgacggcctcgcgctcctcacg
tccggcaacaagttcgacttctcgctcggcaacgcgtacagcttctcgggcgggctcaag
tgctcggtgtcgatgggcggcaacaccgacgtctacgtcggcgtgcgcaacagcctcgac
gtcagcgcgaacttcctgacgacgctgcagggcaacctgcgctggatgctgcccggcagc
cggagcttcgagatcaacgacagcgcatcgacactgctgcagacgctgcacaagcagtcc
gcgacgggtgcgatccggctgtccgccgggcaggacgcgtccgcgctgctgcaaaagcag
ctcgacaagctcaagggcacggtgcgcaagttcatgatcgtgtcgggcctcgcgaacgcc
gggtccgcggccgccgccgcggggctcatcaagggcggcggcaagctcgccgatctgccg
tgggcgggcttcggcatatctgccgcgcagttcgccggcgcgaccggcgtcagcacggcg
ctgatggcgacctcgcgcacgctgctcgcgaacgtcgcgaagctccaggaggcgttgccg
ctcgtcgccgatctgtcgctcggcaagcagggcatcgcgctcgccgcgaagaacctcacg
cacgcgacgcggatgtcgctcaccgtcgacggcgtctcgtggtcgacgcacgcgaagggg
cccggcgcggcgggcgccgcgatgagcgtcggcaagggccgctggggcgtcgaagcggcg
aagcacgcgcacgtccacgcgagcgacacgctgctgttcgcggtgccggccgacccgacg
acccagttcgacctgaaggacctgatcgggctgcgccgcgatctcgacgaatgcatgaag
gacatcgccgatctcgaagccgacatttcggaaaacgaagtgctgtcgaccgatcagaac
acgttcggcgtcagcgcgctcatccccacgccgccgtcgcccgccggcgcgctcgcggcg
gtcgcgatcaaggtgaagcaagcgaagctcgtcgagctgaaggccaagcagaagctcgtc
gcgctgaaggtcgacaacctgcagcagaagttcgcgaagcacgtgcagcacctgagcgcc
gtgcggatgagcgcttccgacgcgcagctcggcttcaagggcaaccggctcgtcgcgacg
gccgacggcgtcacgctcgcgcatgcgcagggcaaggcgaagctcgacgtgcgcgaagcg
aagatcggcgtcacggcgggcaaatcgagcgtcgagctcgacgaaggcaagatcgcggcc
ggctgcggcagcgcatcgctgaagctcggcagcgacggcgcgatcgacgtgagcgcgacc
gacgtcaagctgaacggcaccaacgtcaagctgaacggcagcgcgtcgctgaagttcgac
ggccaactgatccagctcggctga

DBGET integrated database retrieval system