KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2045
Entry
BURPS1106A_A2045  CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB
Motif
Pfam: UCH Big_5
Other DBs
NCBI-ProteinID: ABN94574
UniProt: A3P6W7
Position
II:2017927..2018781
AA seq 284 aa
MRRPTIELEFDRAIEPGSVPHIALRADDGTSVAVGPLSWLSDRRIAFAPRKPLKSNSRYE
IMVPAGIRSTTGERSAHPLTSSFDTAPVTPPRGLPNLDGASCFINTALQLAVHSSALDDI
LSNEAVPPAVRTLLEDYDAASADALDAQLAAAVAALRATPEVPDSGPGQTLEVMQALRMP
LYDTSSANNATNNADAIRHAPPNTKAFFLNSYPPLSYADLPNHDRLVAFDYSTGGHYVAY
VKRDGIWYRIDDAQVSAVNEQDLLALPAFNPANGSVSIEIAIYR
NT seq 855 nt   +upstreamnt  +downstreamnt
ttgcgccgcccgacgatcgaactcgaattcgatcgcgcgatcgagccgggttcagtccca
cacatcgcgctgcgcgccgacgatggcacgagcgtcgccgtcggcccgttgtcgtggctg
agcgatcgccggatcgcgttcgcgccgcgcaaaccgctcaagtcgaacagccgctacgaa
atcatggtgcccgccggcatcaggagcaccacgggcgaacggtcggctcatccgctaacg
agcagcttcgataccgcgcccgtcacgccgccgcgcggcctgcccaatctcgacggcgcc
tcgtgcttcatcaacacggcgctgcaattggcggttcactcgtcggcgctcgacgacatt
ctgtcgaacgaagccgtcccgcccgccgtccgcacgctgctcgaagactacgacgccgca
tcggctgacgcactcgacgcgcagttggccgccgcggtcgccgcgctgcgcgccacgccg
gaggtcccggacagcgggccgggacaaacgctggaagtgatgcaagcgttgcggatgccg
ttatatgacacgagcagcgcgaacaacgcaacgaacaacgccgacgccatacgtcatgcg
ccgcccaacaccaaggcgttctttctgaactcctatccaccgctttcctacgcggatctg
ccgaaccacgaccggctcgtcgcgttcgactacagcacgggcggtcactatgtcgcttat
gtgaagcgggatggaatctggtatcgaatcgacgatgcccaggtcagcgccgtcaacgaa
caggacttgcttgccctgccggcgttcaaccccgctaacggcagcgtgtcgatcgaaatc
gcgatctatcgatga

DBGET integrated database retrieval system