KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2391Help
Entry
BURPS1106A_A2391  CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein TIGR00294
  KO
K09007  GTP cyclohydrolase IB [EC:3.5.4.16]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00790  Folate biosynthesis
bpl01100  Metabolic pathways
Module
bpl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BURPS1106A_A2391
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BURPS1106A_A2391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCHY-1 Acetyltransf_6
Motif
Other DBs
NCBI-ProteinID: ABN93081
UniProt: A3P7W3
Position
II:complement(2367677..2368486)
Genome map
AA seq 269 aa AA seqDB search
MNLMNPEFAMPDVQSTVDTRQMPIQRVGVRAVRHPLTVRTAEGETQATVGTWNLDVHLPA
DQKGTHMSRFVALLEERGGPLTADAFRTMLATMLEKLEARAGRIEVSFPYFVNKTAPVSG
VRSLLDYEVTLTGDVRDGLTRVFAKVLVPVTSLCPCSKKISQYGAHNQRSHVTIDAELAA
DVPVEDLIRIAEEEASCELWGLLKRPDEKFVTERAYENPKFVEDLVRDVARRLDADERIV
AYVLEAENFESIHNHSAYALIERDKRRGA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgatgaatcccgaattcgcgatgcccgacgtgcagagcaccgtcgatacccgg
cagatgccgatccagcgcgtcggcgtgcgcgcggtccggcatccgctgacggtgcgcacc
gcggaaggcgagacgcaggccaccgtcggcacctggaatctcgacgtgcatctgcccgcc
gatcagaagggcacgcacatgtcgcgcttcgtcgcgctgctcgaggagcgcggcgggccg
ctgaccgccgatgcgttccgcacgatgctggcgacgatgctcgagaagctcgaggcgcgg
gcggggcgcatcgaggtgtcgtttccgtatttcgtgaacaagacggcgcccgtgtcgggc
gtgcgcagcctgctcgattacgaggtgacgctgacgggcgacgtgcgcgacgggctcaca
cgcgtgttcgcgaaggtgcttgtgccggtgacgagcctttgcccgtgctcgaagaagatt
tcccagtacggcgcgcacaaccagcgctcgcacgtgacgatcgacgcggagctcgcggcc
gacgtgccggtcgaagatctgatccggatcgcggaggaagaggcctcgtgcgagctatgg
ggcctcctgaagcgtcccgacgagaagttcgtcaccgagcgcgcgtacgagaatccgaag
ttcgtcgaggatctggtgcgcgacgtcgcgcggcggctcgatgcggacgagcggatcgtc
gcctatgtgctcgaggcggagaatttcgagtcgatccacaatcacagcgcgtacgcgctg
atcgagcgagacaagcggcgaggcgcgtga

DBGET integrated database retrieval system