KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2831
Entry
BURPS1106A_A2831  CDS       T00480                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
bpl  Burkholderia pseudomallei 1106a
Brite
KEGG Orthology (KO) [BR:bpl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bpl02044]
    BURPS1106A_A2831
Secretion system [BR:bpl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BURPS1106A_A2831
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABN93711
UniProt: A3P950
Position
II:complement(2774607..2776478)
AA seq 623 aa
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLTARV
QLKMDAEFPRFTQALLDAVYPGYVAPLPSMAIVQFTPMMNEGSLAQGYRLPAGTALRARP
AAAEQTACEFRTAHDLTLWPLELAGASVTGAPAYLPRSATAARRDVRGALRIRLKARGGA
GLAQLPIDRLMFHLAGPERDALHLLELIAGHTIGVVCHDAAQPPRWLHALGAHALAHQGF
DADQALLPDEGRSFHGYRLLREYFAFPARFLFFSIEGLRPALARATGDTFELTLLLDRHD
AALENSVDARHLALNCTPAVNLFARRADRIPVHPGAREHHVVVDRSRPLDYEVYAVRRLA
GEQRDDGQMRAFRPFHASFAGDGGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETFVS
LVDSACAPYDESIRYLSVDTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAMIRGPSRPR
PPLADAQSAWRLVSHLGLARHTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRV
AFAPVFRRLPAAGPLMFGRGVQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAEC
VLSSAQRGRLAQWPARVGRRPAI
NT seq 1872 nt   +upstreamnt  +downstreamnt
atggatacgcgcctgctcgactactacaaccgcgagctcgcgtatctgcgcgagttgggc
ggcgagttcgcgcagcagtttccgaaagtggccgcgcgcctgcggatgcacgaatcgggg
ccgcccgatccgtacgtcgagcggctgctcgaaggcttcagctttctcaccgcgcgcgtg
caactgaagatggacgcggagtttccgcgcttcacgcaggcgctgctcgacgcggtgtat
ccgggttacgtcgcgccgcttccgtcgatggcgatcgtgcagttcacgccgatgatgaac
gaaggcagcctcgcgcagggctaccggctgccggcgggcaccgcgctgcgcgcgcggccc
gccgcggccgaacagaccgcgtgcgagtttcgcaccgcgcacgatctgacgctgtggccg
ctggagctcgcgggcgcttcggtgacgggcgcgcccgcgtatctgccgcgttcggcgacg
gccgcgcgccgcgacgtgcgcggcgcgctgcgcatccggctgaaggcgcgcggcggcgcg
ggcctcgcgcaactgccgatcgatcggctgatgttccacctggcgggccccgagcgcgac
gcgctgcatctgctcgaactgatcgccgggcatacgatcggcgtcgtctgccacgacgcg
gcgcagccgccgcgctggctgcacgcgcttggcgcgcacgcgctcgcgcatcagggcttc
gacgccgatcaggcgctgctgcccgacgaaggccgcagcttccacggttaccggctgctg
cgcgagtacttcgcgtttcccgcgcgcttcctgttcttcagcatcgaaggattgcggccc
gcgctcgcgcgcgcgacgggcgacacgttcgagctgacgctgctgctcgatcggcacgac
gcggcgctcgagaacagcgtcgatgcgcggcacctcgcgttgaactgcacgccggccgtc
aacctgttcgcgcggcgcgcggaccgcattccggtccatccgggcgcgcgcgagcatcat
gtcgtcgtcgatcgcagccggccgctcgactacgaggtctacgcggtgcggcggctcgcg
ggcgagcagcgcgacgacgggcagatgcgcgcgttccggccgttccatgcgtcgttcgcg
ggcgacggcggcaattacggcgcgtactacacggtgcgccgcgagccgcgcctcgtgtcc
gcgcaggcgcgcgcgaacggcacgcgcaccggctacgtcggcagcgagacgttcgtgtcg
ctcgtcgatagcgcgtgcgcgccgtatgacgaatcgatccgctatctgtccgtcgacacg
ctgtgcacgaaccgcgatctcgtcctgctgttgccggcgggcgacgcgaacgcgttcacg
ctgcgcgtgtcggcgcccgtcgagcggatcgccatgatccgcgggccgtcgcggccgcgc
ccgccgctcgccgacgcgcagagcgcgtggcggctcgtgagccatctcgggctcgcgcgc
cacacgctgaccgatgtcgacgacgaagaaggcgcgcgcgtgctgcgcgaattgctcggc
ctgcacgcggacccggccgatgcggcgatgcgccggcagatcgacggcgtgcatcgtgtc
gcgttcgcgccggtgtttcgccggctgcccgccgccgggccgctgatgttcgggcgcggc
gtgcaggtggacgtgaccgtcgacgatcatgcgttctccggcgacagcccctatttgctc
ggcgcggtgctcgagcagtttttcgcgcggcacgtgtcgatcaactcgttcgccgaatgc
gtgctgagcagcgcgcagcgcggcaggctcgcgcaatggccggcgcgcgtcggcaggcgg
cccgcgatatga

DBGET integrated database retrieval system