KEGG   Burkholderia plantarii ATCC 43733: bpln_1g07690Help
Entry
bpln_1g07690      CDS       T04139                                 

Definition
(GenBank) oxalate decarboxylase OxdD
  KO
K01569  oxalate decarboxylase [EC:4.1.1.2]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00630  Glyoxylate and dicarboxylate metabolism
bpla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    bpln_1g07690
Enzymes [BR:bpla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.2  oxalate decarboxylase
     bpln_1g07690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_1 Cupin_2 Cupin_3 AraC_binding MannoseP_isomer 3-HAO
Motif
Other DBs
NCBI-ProteinID: ALK29594
UniProt: A0A0B6RJ39
Position
1:893254..894510
Genome map
AA seq 418 aa AA seqDB search
MTDLKRRSVLVGAAAGAVALGAAAAAKAAEFGNPDTPAQGAINSTPIAISEPGPQNPQLR
DVLPSFNNPPATDVGGMPIPWASFNLAHKRIQAGGWAREVTTKAFPVSKDIAGVNMRLGP
GGVRELHWHQQAEWAIMVSGQVRITTIDTKGRAEVADVQSGDIWYFPPGLPHSLQGLGDN
GGEFVLAFDNGAAGEFNTLMVSDWLAHTPPDILAQNFGVPAEKFKEIPLEQLWIYQGAKA
GPLAADQAYAASPDGRPDHPFVFRMSAMAPTLSTSGGEVRIVDSHNFPVSKTVAAALVTV
KPGGLRELHWHPDNDEWQYFIKGNGRMTVFNTGPAAQTVDFSPGDVGYVEKNLGHYIKNT
GKEDLVFLEIFKSDHFSEVTLSQWLASVPRQLLREHLRVDDETLDAIHNLKRRRDVIA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttgaaacgtcgtagcgtcctggtcggcgcggccgccggtgcggtggcactg
ggggcggcggccgccgcgaaggcggccgagttcggcaatcccgacacgccggcgcagggc
gccatcaattcgacgccgatcgcgatttccgagccggggccgcagaacccgcagttgcgc
gacgtgctgccgtcgttcaacaacccgcccgccaccgacgtcggcggcatgccgatcccg
tgggcctcgttcaacctcgcgcacaagcgcatccaggcgggcggctgggcgcgcgaggtg
accaccaaggcgttcccggtgtcgaaggacatcgccggcgtgaacatgcggctcgggccg
ggcggcgtgcgcgagctgcactggcaccagcaggccgagtgggcgatcatggtcagcggc
caggtgcgcatcaccaccatcgacaccaagggccgcgccgaggtggccgacgtgcagagc
ggcgacatctggtatttcccgccgggcctgccgcactcgctgcaggggctgggcgacaac
ggcggcgaattcgtgctggcgttcgacaacggcgcggccggcgaattcaacacgctgatg
gtgtccgactggctcgcgcacacgccgccggacatcctcgcgcagaacttcggcgtgccg
gccgagaagttcaaggagatcccgctcgagcagctgtggatctaccagggcgccaaggcc
ggcccgctcgccgccgaccaggcctacgcggcgtcgccggacggccgccccgatcatccg
ttcgtgttccgcatgagcgcgatggcgccgaccctctcgacctcgggcggcgaggtgcgg
atcgtcgacagccacaacttcccggtctcgaagacggtggccgcggcgctcgtgacggtc
aagccgggcggcctgcgcgagctgcactggcacccggacaacgacgagtggcagtacttc
atcaagggcaacggccgcatgacggtgttcaacaccgggccggccgcgcagaccgtcgac
ttcagccccggcgacgtcggctacgtcgagaagaacctcggccactacatcaagaacacc
ggcaaggaggatctggtgttcctcgagatcttcaagtcggaccacttctcggaggtcacg
ctctcgcagtggctcgccagcgtgccgcgccagctgctgcgcgaacatctgcgcgtggac
gacgagacgctcgacgcgatccacaacctgaagcgtcgtcgcgacgtgatcgcctga

DBGET integrated database retrieval system