KEGG   Burkholderia plantarii: bpln_1g21310Help
Entry
bpln_1g21310      CDS       T04139                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpla  Burkholderia plantarii
Pathway
bpla00071  Fatty acid degradation
bpla00072  Synthesis and degradation of ketone bodies
bpla00280  Valine, leucine and isoleucine degradation
bpla00310  Lysine degradation
bpla00362  Benzoate degradation
bpla00380  Tryptophan metabolism
bpla00620  Pyruvate metabolism
bpla00630  Glyoxylate and dicarboxylate metabolism
bpla00640  Propanoate metabolism
bpla00650  Butanoate metabolism
bpla00900  Terpenoid backbone biosynthesis
bpla01100  Metabolic pathways
bpla01110  Biosynthesis of secondary metabolites
bpla01120  Microbial metabolism in diverse environments
bpla01130  Biosynthesis of antibiotics
bpla01200  Carbon metabolism
bpla01212  Fatty acid metabolism
bpla02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    bpln_1g21310
   00630 Glyoxylate and dicarboxylate metabolism
    bpln_1g21310
   00640 Propanoate metabolism
    bpln_1g21310
   00650 Butanoate metabolism
    bpln_1g21310
  09103 Lipid metabolism
   00071 Fatty acid degradation
    bpln_1g21310
   00072 Synthesis and degradation of ketone bodies
    bpln_1g21310
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bpln_1g21310
   00310 Lysine degradation
    bpln_1g21310
   00380 Tryptophan metabolism
    bpln_1g21310
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bpln_1g21310
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bpln_1g21310
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    bpln_1g21310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bpla04147]
    bpln_1g21310
Enzymes [BR:bpla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     bpln_1g21310
Exosome [BR:bpla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bpln_1g21310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALK30903
UniProt: A0A0N7J1U5
Position
1:complement(2518309..2519490)
Genome map
AA seq 393 aa AA seqDB search
MTDVVIVSAARTAVGKFGGSLAKIAAPELGATVIRAVLERGGVAPDQINEVILGQVLTAG
SGQNPARQSVIKAGLPTAVPGMTINKVCGSGLKAVMLAANAIIAGDAEIVIAGGQENMSA
APHVLPGSRDGFRMGDAKLVDTMIVDGLWDVYNQYHMGITAENVAKEYGITREAQDAFAA
QSQNKAEAAQKSGRFDDEIVPIEIPQRKGEPLRFAADEFVRHGVTAESLAGLKPAFTKEG
TVTAANASGLNDGAAAVLVMSAKKAEALGLTPLARIKAYANAGVDPKVMGMGPVPASRRC
LERAGWSVGDLDLMEINEAFAAQALAVHQQMGWDTSKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQKRDAKRGLASLCIGGGMGVALAVERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtagtgatcgtatcggccgcgcgtaccgcggtcggcaagttcggtggttcg
ctggcgaaaatcgcggcgcccgagctcggcgcgaccgtgatccgcgctgtgctcgagcgc
ggcggcgtggcgccggaccagatcaacgaagtgatcctggggcaggtgctgacggccggc
tcgggccagaacccggcgcgccagtcggtgatcaaggcggggctgccgacggccgtgccc
ggcatgaccatcaacaaggtctgcggctcgggcctgaaggccgtgatgctggccgccaac
gcgatcatcgccggcgacgccgagatcgtgatcgcgggcggccaggaaaacatgagcgcg
gcgccgcacgtgctgccgggctcgcgcgacggcttccggatgggcgacgcgaagctggtc
gacacgatgatcgtggacggcctgtgggacgtctacaaccagtaccacatgggcatcacg
gccgagaacgtcgcgaaggaatatggcatcacgcgcgaggcgcaggacgcgttcgccgcg
cagtcgcagaacaaggccgaggccgcccagaagtcgggccgtttcgacgacgagatcgtg
ccgatcgagatcccgcagcgcaagggcgagccgctgcgcttcgccgccgacgagttcgtg
cgccacggcgtgacggccgagtcgctggcgggcctgaagccggccttcacgaaggaaggc
acggtgacggccgccaacgcgtcgggcctcaacgacggcgcggccgcggtgctggtgatg
tcggcgaagaaggccgaggcgctcggcctcacgccgctcgcgcgcatcaaggcctatgcg
aacgccggcgtcgatccgaaggtgatgggcatgggcccggtgccggcctcgcgccgctgt
ctggaacgtgcgggctggtcggtcggcgatctcgacctgatggagatcaacgaggcattc
gcggcgcaggcactggccgtgcatcaacagatgggctgggacacctcgaaggtgaacgtc
aacggcggcgcgatcgcgattggccatccgatcggcgcgtccggctgccggatcctcgtc
acgctgctgcacgagatgcagaagcgcgatgccaagcgtggcctcgcgtcgctctgcatc
ggcggcgggatgggtgtcgcgctggcggtcgagcgcccctga

DBGET integrated database retrieval system