KEGG   Burkholderia plantarii ATCC 43733: bpln_1g30430Help
Entry
bpln_1g30430      CDS       T04139                                 

Definition
(GenBank) Succinyl-CoA synthase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00020  Citrate cycle (TCA cycle)
bpla00640  Propanoate metabolism
bpla00660  C5-Branched dibasic acid metabolism
bpla01100  Metabolic pathways
bpla01110  Biosynthesis of secondary metabolites
bpla01120  Microbial metabolism in diverse environments
bpla01130  Biosynthesis of antibiotics
bpla01200  Carbon metabolism
Module
bpla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    bpln_1g30430
   00640 Propanoate metabolism
    bpln_1g30430
   00660 C5-Branched dibasic acid metabolism
    bpln_1g30430
Enzymes [BR:bpla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     bpln_1g30430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig DUF1611_N
Motif
Other DBs
NCBI-ProteinID: ALK31809
UniProt: A0A0B6RW32
Position
1:complement(3582893..3583774)
Genome map
AA seq 293 aa AA seqDB search
MSILINKDTKVITQGITGKTGQFHTRACREYANGREAFVAGVNPKKAGEDFEGIPIYASV
KEAKAETGATVSVIYVPPAGAAAAIWEAVEADLDLAICITEGIPVRDMIEVKDRMRREGR
KTLLLGPNCPGTITPDELKIGIMPGHIHRKGRIGVVSRSGTLTYEAVAQLTALGLGQSSA
VGIGGDPINGLKHIDVMQMFNDDPDTDAVVMIGEIGGPDEATAAEWIKGNMKKPVVGFIA
GVTAPPGKRMGHAGALISGGADTAEAKLEIMDACGIKVTRNPSEMGRLLKAAI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattctgatcaacaaagacaccaaggtcatcacgcagggcatcaccggcaagacg
ggccagttccacacgcgcgcgtgccgcgagtacgcgaacggccgcgaggcattcgtcgcg
ggcgtgaacccgaagaaggccggcgaggatttcgaaggcattccgatctacgcgagcgtc
aaggaagcgaaggccgaaaccggcgcgaccgtgtcggtcatctacgtgccgccggcaggc
gcggcagcggcgatctgggaagccgtcgaggccgatctcgatctcgcgatctgcatcacg
gaaggcatccccgtgcgcgacatgatcgaggtgaaggaccgcatgcgccgtgaaggccgc
aagacgctgctgctcgggccgaactgcccgggcacgatcacgccggacgaactgaagatc
ggcatcatgccgggccacatccaccgcaagggccgcatcggcgtcgtgtcgcgttcgggc
acgctgacgtatgaagccgttgcgcagctgacggcactgggcctcggccagtcgtcggcg
gtcggtatcggcggcgacccgatcaacggcctcaagcacatcgacgtgatgcagatgttc
aacgacgatccggacacggacgcggtcgtgatgatcggcgaaatcggcggcccggacgaa
gcgacggcagccgagtggatcaagggcaacatgaagaagccggtggtcggcttcatcgcc
ggcgtcacggcgcccccgggcaagcgcatgggccacgccggcgcgctgatctcgggcggt
gccgatacggccgaagcgaagctggaaatcatggacgcgtgcggcatcaaggtcacgcgc
aacccgtcggaaatgggccgtctgctgaaggcagcgatctga

DBGET integrated database retrieval system