KEGG   Burkholderia plantarii ATCC 43733: bpln_1g31630Help
Entry
bpln_1g31630      CDS       T04139                                 

Definition
(GenBank) Esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
bpla  Burkholderia plantarii ATCC 43733
Pathway
bpla00903  Limonene and pinene degradation
bpla00930  Caprolactam degradation
bpla01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    bpln_1g31630
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    bpln_1g31630
Enzymes [BR:bpla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     bpln_1g31630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Peptidase_S9 Abhydrolase_2
Motif
Other DBs
NCBI-ProteinID: ALK31927
Position
1:complement(3729819..3730781)
Genome map
AA seq 320 aa AA seqDB search
MSWQSTFACWLLRWQIRPKTLSPVIDVAGTRVLAARRRVLPTRPPAGWRLRQGGAGDIDG
HVGVSTDGAPRGEWLEPADGRAAPTLLYFHGGGYYFCSPATHRPLVFALSRKLGARSFSV
DYRLAPEHPFPAAHDDALAAYAALLEAGIDPGSILIGGDSAGGGLALALLVALRDRGAPL
PAGALLFSPWTDLAATGDTLRSNDGLDPMFSGAALGRAARLYIGGASPTDPYLSPLYADP
AGLPSLLIQVGSTEVLLDDSRRFAERARAAGVDTELQVWPGMPHVWQMAVPFMPEASRAL
DQAAAFGRRLVERPAQPVAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaatccaccttcgcctgctggctgctgcgctggcagatccgtccgaagacg
ctgtcgccggtgatcgacgtggcgggcacgcgcgtgctggcggcgcgccggcgcgtattg
cccacgcgcccgcccgccggctggcggctgcgccagggcggcgcgggtgatatcgacgga
cacgttggcgtgagcaccgacggcgcgccgcgcggcgaatggctcgagccggccgacggc
cgcgcggcgccgacgctgctgtatttccacggcggcggctattacttctgttcgcctgcc
acccatcgtccgctggtgttcgcgctgagccgcaagctcggcgcgcgctcgttttcagtc
gattaccggctcgcgcccgagcatccgttcccggccgcgcacgacgacgcgctggccgcc
tatgccgcgctgctcgaggccggcatcgatccgggctcgatcctgatcggcggcgattcg
gcgggcggcggcctcgcgctggcgctgctggtcgcgctgcgcgaccgcggcgcgccgctg
ccggccggggcgctgctgttctcgccgtggaccgatctggccgccacgggcgacacgctg
cgcagcaacgacggcctcgacccgatgttctccggcgcggcgctgggccgcgccgcgcgc
ctgtacatcggcggcgccagtcccaccgatccgtacctgtcgccgctctatgccgacccg
gccgggctgccgtcgctgctgatccaggtcggcagcaccgaggtgctgctcgacgattcg
cgccgcttcgccgagcgcgcgcgggcggccggcgtcgataccgaactgcaggtctggccg
ggcatgccgcatgtctggcagatggccgtgccgttcatgcccgaggcgagccgcgcgctc
gatcaggcggccgcgttcgggcgccggctggtcgagcggccggcgcagccggtggcggcc
tag

DBGET integrated database retrieval system