KEGG   Burkholderia plantarii ATCC 43733: bpln_2g05460Help
Entry
bpln_2g05460      CDS       T04139                                 

Definition
(GenBank) Phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bpla  Burkholderia plantarii ATCC 43733
Brite
KEGG Orthology (KO) [BR:bpla00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    bpln_2g05460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ALK32809
UniProt: A0A0B6S5I7
Position
2:complement(690025..691605)
Genome map
AA seq 526 aa AA seqDB search
MNQSASPTADPGRSRQFGLVVFLVVLVAGGAYVLSHLMADLAPVGEHSVFPYVLLGIALL
IALGFEFVNGFHDTANAVATVIYTHSLTPNVAVVWSGLWNFAGVLLSSGAVAFGILQLLP
VELILQVGSAAGFAMVFALLIAAIVWNLATWYFGLPSSSSHTLIGSIIGVGVMNQLMHGA
SGTSGVDWSQALGVGKSLLFSPIVGFVLSGLLLLLLKGLVKVPQLYQEPPKDKTPPFWIR
CLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTPAESQTFIAVAHQAA
ATFGKYTNGAAAPVNSRRVVETYVQTRQMTPDTVPAVQQLSNSLAAAVGSTGSIASTPQG
DVDNLRNTMYLESEAIRLMDKAKQPAFSADDRAAINNYRAMLDHATKFIPTWVKVAVALA
LGLGTMVGWKRIVITVGEKIGKQHLTYGQGASAEVVAMVTIGAADMYGLPVSTTHVLSSG
VAGTMAANGSGLQWSTVRSLVLAWVLTLPASIVLAGGLYWVFHALF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaatccgcgtcacccaccgcagatcccggccgctcacggcaattcggcctggtg
gtcttcctcgtcgtactcgtcgccggcggcgcgtatgtgctctcccacctgatggccgat
ctcgcgccggtcggcgagcattcggtgttcccctacgtgctgctcggcatcgcgctgctg
atcgcgctcggcttcgaattcgtcaacggcttccacgacacggccaacgcggtcgccacc
gtgatctacacgcattcgctgacgccgaacgtggccgtggtctggtccgggctctggaat
ttcgcgggcgtgctgctctcgagcggtgccgtcgcgttcggcatcctgcagttgctgccc
gtcgagctgatcctgcaggtcggcagcgccgccggcttcgcgatggtgttcgcgctgctg
atcgccgcgatcgtctggaacctcgcgacctggtacttcggcctgccgtcatcgagctcg
cacacgctgatcggctcgatcatcggcgtcggcgtgatgaaccagctcatgcacggcgcc
tcgggcacgagcggcgtggactggagccaggcgttgggcgtcggcaagtccctgctgttc
tcgccgatcgtcggcttcgtgctctcgggcctgttgctgctcctgctcaaggggctcgtg
aaggtgccgcagctctatcaggagccgccgaaggacaagacgccgccgttctggatccgc
tgcctgctgatcctgacctgcaccggcgtgtcgttcgcgcacggctcgaacgacggccag
aagggcatgggcctcatcatgctgatcctgatcggcaccgttcccaccgcctacgcgctg
aacaaggcggtcacgccggccgaatcgcagaccttcatcgccgtcgcgcaccaggcggcc
gcgaccttcggcaagtacaccaacggcgccgcggcgcccgtcaactcgcgccgcgtggtc
gagacctacgtgcagacgcgccagatgacgccggacaccgtacccgccgtgcagcagctg
tcgaactcgctcgcggccgcggtcggctcgaccggctcgatcgcgagcaccccgcagggc
gatgtcgacaacctgcgcaacaccatgtacctggagtcggaagcgatccgcctgatggac
aaggccaagcagccggccttctccgccgacgatcgcgccgcgatcaacaactatcgcgcg
atgctcgatcacgccaccaagttcatcccgacctgggtcaaggtcgccgtggcgctcgcg
ctcggcctcggcacgatggtcggctggaagcggatcgtgatcactgtcggcgagaagatc
ggcaagcagcatctgacctacggccagggcgcctcggccgaagtcgtcgcgatggtcacg
atcggcgcggccgacatgtacgggctgccggtctcgaccacgcacgtgctgtcgtcgggc
gtggccggcacgatggcggccaacggctcgggcctgcaatggtcgaccgtgcgcagcctg
gtgctggcctgggtgctgacgctgccggcctcgatcgtgctggccggcggactctactgg
gtattccacgcgctgttctga

DBGET integrated database retrieval system