KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0206Help
Entry
BURPS1710b_0206   CDS       T00289                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00360  Phenylalanine metabolism
bpm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpm00790  Folate biosynthesis
bpm01100  Metabolic pathways
bpm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BURPS1710b_0206 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BURPS1710b_0206 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BURPS1710b_0206 (phhA)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BURPS1710b_0206 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ABA47543
UniProt: Q3JXT1
Position
I:214145..215155
Genome map
AA seq 336 aa AA seqDB search
MMRNYRIYPYTIAHFAPKPREPRSTLACIPTTDAKQGYPMSTVVTAKLKEQFDAGLETRA
DFTIDQPLARYGDVDHAVWTQLYTRQAALLRGRACDAFIEGLARIGLAPDRVPSFADVNR
RLEPATGWRIVAVPGLVPDAVFFEHLANRRFPVTWWMRRPDQLDYLQEPDCFHDLFGHVP
LLIDPVFADYMHAYGRAALRVADDASALALLARLYWYTVEFGLIRDTRGENGLRIYGAGI
VSSKGETLYSLESTSPNRIGFDLERVMRTRYRIDTFQKTYFVIDDFAQLFALADLDARAL
AARLAGAPEHAAGAVLDGDHVLTRGTGEGWAADADA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcgcaattatcgcatttatccatacacaatcgcccattttgcgcccaaaccgcgc
gagccccgctctacacttgcatgcatccccaccactgatgcgaagcagggctaccccatg
tccacggtcgttaccgcgaaactgaaggaacagttcgacgcgggcctcgaaacccgcgcc
gatttcaccatcgatcagccgctcgcccgctacggcgacgtcgaccacgcggtgtggacg
cagttgtatacgcggcaggcggcgctgctgcgcggccgtgcatgcgacgcgttcatcgag
ggcctcgcgcgcatcggcctcgcgcccgatcgcgtgccgtcgttcgccgacgtgaaccgg
cggctcgagcccgcaaccggctggcgcatcgtcgcggtgccgggcctcgtgccggacgcc
gttttcttcgagcatctcgcgaaccggcggtttccggtcacctggtggatgcgccgcccg
gaccagctcgattatctacaggagccggactgcttccacgatctgttcggccacgtgccg
ctgctgatcgatcccgtattcgccgactacatgcacgcatacggccgcgcggcgcttcgc
gtcgccgacgacgcaagcgcgctcgcgctccttgcgcgcctctattggtatacggtcgaa
ttcggcctgattcgcgacacgcgcggcgaaaacgggctgcggatctacggcgcgggcatc
gtgtcgagcaagggcgaaacgctctacagcctcgaaagcacgtcgccgaaccggatcggc
ttcgatctcgaacgcgtgatgcggacccgataccggatcgacacgttccagaagacctac
ttcgtgatcgacgatttcgcgcaactcttcgcgctcgccgacctcgacgcgcgcgcgctc
gccgcgcggctcgccggcgcgcccgagcacgcggcgggcgcggtgcttgacggcgatcat
gtgctcacgcgcggcaccggtgaaggctgggcagccgatgcagacgcttga

DBGET integrated database retrieval system