KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0291
Entry
BURPS1710b_0291   CDS       T00289                                 

Definition
(GenBank) hypothetical protein
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB
Other DBs
NCBI-ProteinID: ABA48652
UniProt: Q3JXJ6
Position
I:298606..299214
AA seq 202 aa
MHTPARPMRARRANCTRRGICVELSRRLIVSRICPTIRFAWLVAAIRIPLIKTEGTMPYV
STHYSNNASAPVGRWTCAPTSKLAPFDKTPTGSVTSGVDLCGQCVSYVKRVCPTLPLTGQ
WRKGAPVKGNATIVAGTMIATFNAAGKYDGHAAIYVSQTKDGGILVYDQFVTPPTPQPVR
QRRLRWGAHGRSNNGDNFYVVE
NT seq 609 nt   +upstreamnt  +downstreamnt
atgcatacgccggcacggccgatgcgcgcgcgacgcgcaaactgcacgcggcgcgggatt
tgtgttgaattgtcgcggcggttgatcgtttcgcgcatctgcccgacaatccggttcgct
tggctggttgcggcaattcgaattccgcttataaaaaccgagggaaccatgccttacgtg
tcgacccattactcgaacaacgccagcgcgccggtcggccgctggacctgcgcgccgact
tcgaagctcgcgcctttcgacaagacgccgacgggcagcgtcacgtccggcgtcgatctg
tgcggccaatgcgtgtcctacgtgaaacgggtctgcccgacgctgccgctcaccgggcaa
tggcgcaagggcgcgccggtgaaaggcaacgcgacgatcgtcgcgggcaccatgatcgcg
acgttcaacgccgccggcaagtacgacggccacgcggcgatctacgtcagccagacgaag
gacggcggcatcctggtgtacgaccagttcgtgacgccgccgacgccgcagccggttcgg
caacggcgcctgcgctggggcgcgcatggtcggtcgaacaatggggataacttctatgtc
gtggagtaa

DBGET integrated database retrieval system