KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0579Help
Entry
BURPS1710b_0579   CDS       T00289                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00071  Fatty acid degradation
bpm00072  Synthesis and degradation of ketone bodies
bpm00280  Valine, leucine and isoleucine degradation
bpm00310  Lysine degradation
bpm00362  Benzoate degradation
bpm00380  Tryptophan metabolism
bpm00620  Pyruvate metabolism
bpm00630  Glyoxylate and dicarboxylate metabolism
bpm00640  Propanoate metabolism
bpm00650  Butanoate metabolism
bpm00900  Terpenoid backbone biosynthesis
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01120  Microbial metabolism in diverse environments
bpm01130  Biosynthesis of antibiotics
bpm01200  Carbon metabolism
bpm01212  Fatty acid metabolism
bpm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BURPS1710b_0579 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    BURPS1710b_0579 (fadA)
   00640 Propanoate metabolism
    BURPS1710b_0579 (fadA)
   00650 Butanoate metabolism
    BURPS1710b_0579 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    BURPS1710b_0579 (fadA)
   00072 Synthesis and degradation of ketone bodies
    BURPS1710b_0579 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BURPS1710b_0579 (fadA)
   00310 Lysine degradation
    BURPS1710b_0579 (fadA)
   00380 Tryptophan metabolism
    BURPS1710b_0579 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BURPS1710b_0579 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BURPS1710b_0579 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BURPS1710b_0579 (fadA)
Enzymes [BR:bpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BURPS1710b_0579 (fadA)
Exosome [BR:bpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BURPS1710b_0579 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABA48979
UniProt: Q3JWR0
Position
I:complement(591693..592886)
Genome map
AA seq 397 aa AA seqDB search
MTAVDQDPIVIASAARTPIAGFQGEFASLAAPQLGAAAIAAALERAGLQPEQIDEAVMGC
VLPAGQGQAPARQAALGAKLPLSVGCTTINKMCGSGMRAAMFAHDMLVAGSVDVIVAGGM
ESMTNAPYLLPKARAGMRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEECAGEYAFSRDA
QDAFAIESLARAKRANEDGSFAWEIAPVTVAGKKGDAVIARDEQPFKANPEKIPTLKPAF
SKTGTVTAANSSSISDGAAALVMMRASTANRLGLAPLARVVGHSTFAQAPSKFTTAPVGA
IRRLFEKNGWRAAEVDLYEINEAFAVVTMAAMKEHGLPHEKVNVNGGACALGHPIGASGA
RILVTLIGALRARGAKRGVASLCIGGGEATAMGIELI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgttgatcaggatccgatcgtcatcgcatcggcggcgcgcacgccgatcgcg
ggctttcagggcgagttcgcgtcgctcgccgcgccgcagctgggcgcggccgcgatcgcc
gcggcgctcgagcgcgcgggcctgcaaccggagcagatcgacgaggcggtgatgggctgc
gtgctgcccgccgggcaggggcaggcgccggcacggcaggcggcgctcggcgcgaagctg
ccgctgtcggtcggctgcacgacgatcaacaagatgtgcggctcgggcatgcgcgcggcg
atgttcgcgcacgacatgctcgtggcgggctccgtcgacgtgatcgtcgcgggcggcatg
gaaagcatgacgaacgcgccgtacctgctgccgaaggcgcgcgccggcatgcgcatgggc
cacggccaggtgctcgaccacatgttcctcgacggcctcgaggacgcctacgacaagggc
cggctgatgggcacgttcgccgaggaatgcgcgggcgaatacgcgttctcgcgcgacgcg
caggacgcgttcgcgatcgaatcgctcgcgcgcgcgaagcgggcgaacgaggacggctcg
ttcgcgtgggaaatcgcgcccgtgacggtggccggcaagaagggcgatgcggtgatcgcg
cgcgacgagcagccgttcaaggcgaaccccgagaagattccgacgctcaagcccgcgttc
agcaagacgggcaccgtgaccgccgcgaattcgtcgtcgatctccgacggcgcggccgcg
ctcgtgatgatgcgcgcgtcgacggcgaaccggctcgggctcgcgccgctcgcgcgcgtc
gtcggccattcgacgttcgcgcaggcgccgtcgaagttcacgacggcgcctgtcggcgcg
atccggcgcctgttcgagaagaacggctggcgcgcggccgaggtcgacctgtacgagatc
aacgaagcgttcgcggtcgtcacgatggcggcgatgaaggagcacggcctgccgcacgag
aaggtcaacgtgaacggcggcgcgtgcgcgctcggccatccgatcggcgcgtcgggcgcc
cgcatcctcgtcacgctgatcggcgcgctgcgcgcgcgcggggccaagcgcggcgtggcg
agcctgtgcatcggcggcggcgaagcgaccgcgatgggcatcgagctgatctga

DBGET integrated database retrieval system