KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0655Help
Entry
BURPS1710b_0655   CDS       T00289                                 

Gene name
gshB
Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00270  Cysteine and methionine metabolism
bpm00480  Glutathione metabolism
bpm01100  Metabolic pathways
Module
bpm_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BURPS1710b_0655 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BURPS1710b_0655 (gshB)
Enzymes [BR:bpm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     BURPS1710b_0655 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABA50318
UniProt: Q3JWI4
Position
I:668431..669387
Genome map
AA seq 318 aa AA seqDB search
MDILFIADPLDRFKIYKDSTYAMMAEAARRGHAVYACEPNQLAWTGAGVEADVRRVTIAG
DTADLHRDRWYEAAARESRALPSFGAILMRKDPPFDMEYVTSTWLLELAERAGARVFNKP
QTIRDHSEKLAIGEFAQFVAPSLVTRDAARLRAFHAEHGDVILKPLDGMGGMGVFRVKAD
GMNLGSIIEMLSHDGARSVMVQKFIPEIKAGDKRILLIDGEPVPYSLARIPQGSEVRGNL
AAGGVGVAQPLTERDREIAAALGPVLAARGLLLVGLDVIGDWLTEVNVTSPTCFREIMEQ
TGFDVAGMFVDALERAVG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggacattctctttatcgccgacccgctcgatcgcttcaagatctacaaggactcgacc
tacgcgatgatggccgaggccgcgcggcgcgggcacgcggtgtacgcgtgcgagccgaac
cagcttgcgtggacgggcgcgggcgtcgaggccgacgtgcgccgcgtgacgatcgcgggc
gacacggccgatctgcaccgcgatcgctggtacgaggcggcggcgcgcgagtcgcgcgcg
ctgccttcgttcggtgcgatcctgatgcgcaaggatccgccgttcgacatggaatacgtg
acgtcgacgtggctgctcgagctcgccgagcgtgcgggcgcgcgcgtgttcaacaagccg
cagacgattcgcgatcattccgagaagctcgcgatcggcgagttcgcgcaattcgtcgcg
ccgtcgctcgtcacgcgtgacgcggcgcggctgcgcgcgttccacgccgagcacggcgac
gtgatcctgaagccgctcgacggcatgggcgggatgggcgtgtttcgcgtgaaggcggac
ggcatgaacctcggctcgatcatcgagatgctgagccacgacggcgcgcgctcggtgatg
gtgcagaagttcatccccgagatcaaagccggcgacaagcgcattctgctgatcgacggc
gagccggtgccgtactcgctcgcgcggattccgcagggcagcgaggtgcgcggcaacctg
gcggcgggcggcgtcggggtcgcgcagccgctcaccgagcgcgaccgcgagattgcggcg
gcgctcggcccggtgctcgccgcgcgcggcttgctgctcgtcggcctcgacgtgatcggc
gactggctgaccgaggtgaacgtcacgagcccgacttgctttcgcgaaatcatggagcaa
actggattcgacgtcgccggcatgttcgtcgacgcattggagcgtgcggtcggctga

DBGET integrated database retrieval system