KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0725Help
Entry
BURPS1710b_0725   CDS       T00289                                 

Gene name
bcc1
Definition
(GenBank) chitinase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00511  Other glycan degradation
bpm00520  Amino sugar and nucleotide sugar metabolism
bpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS1710b_0725 (bcc1)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BURPS1710b_0725 (bcc1)
Enzymes [BR:bpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BURPS1710b_0725 (bcc1)
Chaperones and folding catalysts [BR:bpm03110]
 Intramolecular chaperones
  Others
   BURPS1710b_0725 (bcc1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ABA48029
UniProt: Q3JWB3
Position
I:complement(737872..740442)
Genome map
AA seq 856 aa AA seqDB search
MKDPIAATYFHGVVSPFFCQGTPMNRISHSLCAALLAAATLLPTASRAQLPARPTAGAAA
PATAAPVRPASTPAELAARLANGLAVRVAVDNNHAASAGVPCADLGADWASCATGRLILQ
NRGHSPLTDGGWKLYLHSIRRLLRIDRPGFTLRHLTGDLYELTPQPGTVRLAQGERIELP
FVAEYWLRRYSDVIPRPYVVVDGAAPAVLRYDDTDDELRYVETLPADAQNNSPGNAPPAA
AQPVANRALPSVKRQRALPGALDLRGVELTLPELPSAQVAALRERAGTLGLDGARVPVWG
VVAPRRLPADIAVPGGYRLAIGPRGAFIEGADRAGLYYGVQTLFSLVPAGGATVPAMLIE
DAPRFTHRGMHVDLARNFKPPATLRRLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPELT
DVGARRCHDPSETRCLLPQLGSGPDDRSGGGYLTRDDYVALLRYAAERFVEVIPEIDMPA
HSRAAVVSMEARYRRLHAAGREREANAYRLLDAQDTSNLLTVQFYDRRSDLNPCMPGALN
FASKVIREIASMHADAQAPLRIWHFGGDEAKNILLGAGFQPLDGADPGKGRVDLAAQDKP
WARSPACTALLRRGEIKSIDELPTRFAKQVSAIVNANGIGTMAAWQDGIKHASGPREFST
RHVMVSLWDTIFWGASDSARDLSAKGYRTVLALPDYLYFDFPYTRNPRERGYYWGSQATD
EYKVFSLAPENLPQNAEVFGDRDGNPFEVTSAGAAPSIEGIQGQAWGEVMRNGQLLEYMV
YPRLLALAERAWHKADWELPYAAGVRYKLGDTHHVDTAALERDWAGFATVLKQRELPKLE
RAGIGYRKPTFTLTGE
NT seq 2571 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagacccgatcgcagcgacgtatttccacggcgtcgtatcgccgtttttttgccaa
ggaacgcccatgaaccgaatctcgcattccctgtgcgccgcgctattggccgccgcgacg
ctgttgcccacggcctcgcgcgcgcaactgcccgcgcgccccacggccggcgcggccgcg
cccgcgacggccgcgcccgtgcggcccgcgtccacgccggccgagctcgccgcgcggctc
gccaacggcctcgcggtgcgcgtggccgtcgacaacaatcacgcggcatcggccggcgtg
ccgtgcgccgacctcggcgcggactgggcgagctgcgcgacgggccgcctgatcctgcag
aatcgcggccactcgcccctcaccgacggcggctggaagctctatctgcacagcatccgc
cggctgctccgaatcgaccgccccggcttcacgctgcgccatctgacgggcgatctgtac
gagctgacgccgcagcccggcacggtaaggctcgcgcagggcgagcgcatcgagctgccg
ttcgtcgccgaatactggctgcgccgctacagcgacgtgatcccgcgcccgtacgtggtc
gtcgacggcgcggcgcccgcggtgctgcgctacgacgataccgacgacgagctgcgctac
gtcgaaacgctgcccgccgacgcgcagaacaactcgcccggcaatgcgccgcccgccgcc
gcgcagccggtggcgaaccgcgcgctgccgagcgtgaagcggcagcgcgcgctgcccggc
gcgctcgatctgcgcggcgtcgagctgacgctgccggagctgccgtccgcgcaggtcgcg
gcgctgcgcgaacgcgcgggcacgctcggcctggacggcgcgcgcgtgccggtgtggggc
gtcgtcgcgccgcgccggctgcccgccgacatcgcggtgccgggcggctaccggctcgcg
atcggcccgcgcggcgcgttcatcgagggggccgatcgcgcgggcctctactacggcgtg
cagacgctcttctcgctcgtgccggccggcggcgcgacggtgcccgcgatgctgatcgaa
gacgcgccgcgcttcacgcaccgcgggatgcacgtcgatctcgcgcgcaacttcaagccg
cccgccacgctgcgccggctgatcgaccagatgagcgcgtacaagctcaaccggctgcat
ctgcacctgtccgacgacgagggctggcgcatcgagattcccggcctgcccgagctgacc
gacgtcggcgcgcgccgctgccacgacccgagcgagacgcgctgcctgctgccgcagctc
ggctcggggcccgacgatcgttcgggcggcggctacctgacgcgcgacgactacgtcgcg
ctgctgcgctacgcggccgagcgcttcgtcgaagtgatccccgagatcgacatgcccgcg
cactcgcgcgcggccgtcgtatcgatggaggcgcgctatcgccgcctgcacgcggcgggc
cgcgagcgggaagcgaacgcgtatcggctgctcgatgcgcaggacacgtcgaacctgctg
accgtgcagttctacgaccggcgcagcgatctgaacccgtgcatgccgggcgcgctgaac
ttcgcgtcgaaggtgatccgcgagatcgcgtcgatgcacgcggacgcgcaagcgccgctg
cggatctggcacttcggcggcgacgaggcgaagaacatcctgctcggcgcgggcttccag
ccgctcgacggcgccgatcccggcaagggccgcgtcgatctcgccgcgcaggacaagccg
tgggcgcgctcgcccgcctgtacggcgctgcttcggcgcggcgagatcaaatcgatcgac
gaattgccgacgcgcttcgcgaagcaggtcagcgcgatcgtgaacgcgaacggaatcggc
acgatggccgcgtggcaggacggcatcaagcacgcgagcgggccgcgggagttcagcacg
cggcacgtgatggtgtcgctgtgggacaccatcttctggggcgcgtccgacagcgcgcgc
gatctgagcgcgaagggctaccggaccgtgctcgcgctgcccgattacctgtacttcgat
ttcccgtacacgcgcaatccgcgcgagcgcggctattactggggctcgcaggcgacggac
gagtacaaggtgttctcgctcgcgccggagaacctgccgcagaacgccgaggtgttcggc
gatcgcgacggcaacccgttcgaggtgacgagcgcgggcgcggcgccgagcatcgagggc
atccaggggcaggcgtggggcgaggtgatgcgcaacgggcaactgctcgaatacatggtg
tatccgcgccttctcgcgctcgccgagcgcgcgtggcacaaggccgactgggaactgccc
tacgcggccggcgtgcgctacaagctcggcgacacgcatcacgtcgacacggccgcgctc
gagcgcgactgggcgggcttcgcgacggtgctcaagcagcgcgaactgccgaagctcgaa
cgtgcgggcatcgggtatcgcaagccgacgtttacgctgacgggcgaatga

DBGET integrated database retrieval system