KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1247Help
Entry
BURPS1710b_1247   CDS       T00289                                 

Gene name
hisQ
Definition
(GenBank) histidine transport system permease protein
  KO
K10016  histidine transport system permease protein
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bpm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BURPS1710b_1247 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bpm02000]
    BURPS1710b_1247 (hisQ)
Transporters [BR:bpm02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BURPS1710b_1247 (hisQ)
   Histidine transporter
    BURPS1710b_1247 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 ASC
Motif
Other DBs
NCBI-ProteinID: ABA48606
UniProt: Q3JUU5
Position
I:complement(1297821..1298510)
Genome map
AA seq 229 aa AA seqDB search
MFLQGYGPLILSGTWQTVKLAVLSLALSFLLGLVGAAAKLSRNRVSNGIGTLYTTLIRGV
PDLVLMLLLFYSLQIWLNQLTDLMNWDQIDIDPFAAGVLVLGFIYGAYFTETFRGAFLSV
PRGQLEAGSAYGMTNWQVFARVMFPQMMRFALPGIGNNWQVLVKSTALVSIIGLADVVKA
SQDAGKGTLRFFFFTLLAGAIYLAITTISNFVLMWLEKRYSTGVRKADL
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttcaaggctacggcccgctgatactctccggcacctggcagaccgtcaagctc
gcggtgctgtcgctcgcgctgtcgttcctgctcggcctcgtcggcgcggcggcgaaactg
tcgcgaaaccgcgtctcgaacggaatcggcacgctctacacgacgctcattcgcggcgtg
ccggacctcgtgctgatgctgctcctcttctacagcctgcagatctggctgaaccagctc
accgatctgatgaactgggatcagatcgacatcgatccgttcgcggccggcgtgctcgtg
ctcggcttcatctacggcgcgtacttcaccgaaaccttccgcggcgcgttcctgtcggtg
ccgcgcggccagctcgaggcgggcagcgcgtacgggatgacgaactggcaggtgttcgcg
cgcgtcatgttcccgcagatgatgcgcttcgcgctgcccggcatcggcaacaactggcag
gtgctcgtgaaatcgacggcgctcgtgtcgatcatcggcctcgccgacgtggtgaaggcg
tcgcaggacgcgggcaagggcacgctgcggttcttcttcttcacgctgctcgccggcgcg
atctatctcgcgatcacgacgatctcgaacttcgtgctgatgtggctcgagaagcgttat
tcgaccggcgtacgcaaggcagacctatga

DBGET integrated database retrieval system