KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1737Help
Entry
BURPS1710b_1737   CDS       T00289                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00500  Starch and sucrose metabolism
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BURPS1710b_1737 (glgB)
Enzymes [BR:bpm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BURPS1710b_1737 (glgB)
Exosome [BR:bpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BURPS1710b_1737 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase AMPK1_CBM Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ABA50427
UniProt: Q3JTG5
Position
I:complement(1873434..1875650)
Genome map
AA seq 738 aa AA seqDB search
MTDAPFDRADIDALLDARHPDPFACLGPHRVGDATVVRTLLPGALRVRAIAAGGGVLGEL
RQVDPAGCFAGALPDGRERGERPRYRLSIDWPDARQDVEDAYAFGTLLDEDALARFAAGD
PRAALACLGARALDMDGVPGVRFAVWAPGASRVSVVGDFNGWDARRHPMRLRRPWGVWEL
FVPRIGAGERYKFALRARDGAALPLKADPCACRTEAPPRTASIVADLDALERFGWHDDAW
LRARASLDLAHAPVSIYEVHPESWLRVAAEGNRSATWDELAQRLIPYAAGMGFSHVELTP
IAEYPFGGSWGYQSLSPFAPSARFGPPEGFARFVEHAHAAGLGVIVDWVPAHFPDDPHGL
GKFDGTALFEHADPREGWHPDWHTHVFNVGRREVGAFLIASALAWAHRYHVDGIRVDAVA
SMLYRDYSRAAGEWVPNVYGGRENLESIAFLKHFNDTLHGPAAPPGVATFAEESTAWPGV
TAPTAEHGLGFDFKWNMGWMHDTLAYLREDPIHRRHHHDRLTFGLVYAFSERFVLPLSHD
EVVHGKGSLAAKMPGDAWQRLANLRAYFGFMWAHPGKKLLFMGGEFAQWGEFAHDATPQW
DLLDAPAHRGVQRLVRDLNRLHAAEPALHALDDRPAGFAWLVGDDRNNSVFAFVRRDDAG
RMLVAVCNFTPVPRTDYRLGLPAPGRWAEVLNTDGAAYGGTDAGNGGALQADEIPAHGER
WSAALRLPPLATLWLRPA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgcgcccttcgatcgcgccgacatcgacgcgctcctcgacgcgcgccatccg
gacccgttcgcgtgcctcggcccgcaccgcgtcggcgacgcgacggtcgtgcgcacgctg
ctgcccggcgcgctgcgggttcgcgcgatcgcggcgggcggcggcgtgctcggcgagctg
cggcaggtcgatccggccggctgcttcgccggcgcgctgcccgatgggcgggaacgcggc
gagcggccgcgctatcggctgtcgatcgactggcccgacgcgcgacaggacgtggaggac
gcgtatgcgttcggcacgctgctcgacgaggatgcgctcgcgcgcttcgcggcgggcgat
ccgcgcgcggcgctcgcgtgcctcggcgcgcgcgcgctcgacatggatggcgtgcccggc
gtgcggttcgccgtctgggcgccgggcgcgtcgcgcgtgtcggtggtcggcgatttcaac
ggctgggatgcgcgccgccacccgatgcggctgcgccgcccgtggggcgtgtgggagctg
ttcgtgccgcgcatcggcgcgggcgagcgctacaagttcgcgctgcgcgcgcgcgacggc
gccgcgctgccgctgaaggccgacccgtgcgcgtgccgcaccgaggcgccgccgcgcacc
gcgtcgatcgtcgccgatctcgacgcgctcgagcgcttcggctggcacgacgacgcgtgg
ctgcgcgcgcgcgcgtcgctcgatctcgcgcacgcgccggtgtcgatctacgaagtccat
ccggaatcgtggctgcgcgtcgcggccgagggcaatcgcagcgcgacgtgggacgagctc
gcgcagcggctgattccgtatgcggccggcatgggcttctcgcacgtcgagctcacgccg
atcgccgagtatccgttcggcggctcgtggggctaccagtcgctatcgccgttcgcgccg
tccgcgcggttcgggccgccggaaggcttcgcgcgcttcgtcgagcacgcgcacgcggcc
ggcctcggcgtgatcgtcgactgggtgcccgcgcactttcccgacgatccgcacgggctc
ggcaaattcgacggcaccgcgctgttcgagcatgcggacccgcgcgagggatggcatccg
gactggcacacgcacgtgttcaacgtcgggcggcgcgaagtcggcgcgttcctgatcgcg
tcggcgctcgcgtgggcgcaccgctatcacgtcgacggcattcgcgtcgacgccgtcgcg
tcgatgctctaccgcgactactcgcgcgcggcgggcgaatgggtgccgaacgtgtacggc
gggcgcgagaacctcgaatcgatcgcgttcctgaagcacttcaacgacacgctgcacggg
cccgccgcgccgcccggcgtcgcgacgttcgcggaggaatcgaccgcatggcccggcgtc
accgcgccgaccgccgagcacggcctcggcttcgatttcaagtggaacatgggctggatg
cacgacacgctcgcctatctgcgcgaggacccgatccatcgccgccatcaccacgaccga
ctcacgttcgggctcgtctatgcgttctccgagcgcttcgtgctgccgctgtcgcacgac
gaagtcgtgcacggcaagggctcgctcgcggccaagatgccgggcgacgcctggcagcgc
ctcgcgaacctgcgcgcgtacttcggcttcatgtgggcgcatccgggcaagaagctgctg
ttcatgggcggcgagttcgcgcagtggggggagttcgcgcacgacgcgacgccgcagtgg
gatctgctcgacgcgcccgcgcaccggggcgtgcagcgcctcgtgcgcgacctgaaccgg
ctgcatgcggccgagccggcgctgcacgcgctcgacgaccggcccgccgggttcgcgtgg
ctcgtcggcgacgatcgcaacaacagcgtgttcgcgttcgtccgtcgcgacgatgcgggc
cgcatgctcgtcgcggtgtgcaacttcacgccggtgccgcgcaccgactatcggctcggg
ctgcccgcgccgggccgctgggccgaggtgctgaacaccgacggcgccgcatacggcggc
accgacgcgggcaacggcggcgcgctccaagccgacgagattcccgcgcacggcgagcga
tggtcggccgcgctgcgcctgccgccgctcgcgacgctatggctgcgccccgcctga

DBGET integrated database retrieval system