KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1771
Entry
BURPS1710b_1771   CDS       T00289                                 

Definition
(GenBank) Rhs element Vgr protein subfamily, putative
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1
Other DBs
NCBI-ProteinID: ABA49096
UniProt: Q3JTD1
Position
I:1924245..1927085
AA seq 946 aa
MSIPTDVLQALFGGWSQHDRFLWITTPLGANALVAESLHGWEALDDGGFRLQLTALAEHP
SLPLAQLIGAPILIEWQAQEGRDARRPFHGHVIAAELVGYNGGLARVRLVVEPWLTLLRQ
RVDSYNYLDASVVEISEQVFRRYARGVIAPAWRWALADAAKYPKRSLTAQAGESDFDFLE
RLWAEEGIFYWFEHEGDARASSLGKHTLVLADSNQRFAPDEPEIVGFHQTSDDDPQGCIQ
HFMHARRWRIGSVARASWDHRSLSTRPTGARANGAVAPGEDRDVAGPYAYQTGAIGDRRA
QQQLDAQRVAALRSEGRSTRRDLRPGLRFAIAHHPTLGVSDAFICLRVEHSARANVDATV
RSAIEQRLGAIASIAGAAPVPHGPASALNAALGADTHHGGSLMRDDAVYRNRFVALPAEQ
TYRPLAASGHGARMHPVAVMPGAQTAIVVGAGDPVHTDRDHRIRIQHHAQRGENAASRDD
HPHAANAPANRGAGTWTRMMTPVGGDNWGGVSVPRVGQEVWTEWLEGQPDRPVAVAALYN
GRGNAHAQHNAQAGGPSGSTGNAAAWFAGNAHAAVLTGFKTQDMSMSQQGTGGYRQFMLD
DTAGQSSARLYTTDRNSGLTLGHVKQTQDNRRQADRGYGAELATDAAGALRGGAGLLIST
APGVSQMDASAPSQVLAQHRQTLQSLAALAHKQGAEPGGAVPEAAGGAGAASASTGAAAD
KPLPAVDGIEQSREAIGATREGSGGDTAGGGGGGAIAWSKPHLVAHGEAGLAAMSAKSHV
WVSGTETVLSAGQDVQLTAKGKTSVVANHGISLYTQGAAGDGRPVAGRGIALHAASGAVS
VQAQNAGKLSASAQKAVTLASAQGSASVQAQQRVLLSAAKAYLKMEGNDIVVGAPGRADF
KAAAHQLTGPKSAGASAQMPKSEPKLCEYKTRAADVAHEGTMKSAA
NT seq 2841 nt   +upstreamnt  +downstreamnt
atgtcgatccccactgacgttctgcaagcactcttcggcggctggtcgcaacacgaccgc
tttctctggatcacgacgccgctcggcgcgaacgcgctcgtcgcggaaagcctgcacggc
tgggaggcgctcgacgatggcggcttccgtttgcagctcaccgcgctcgccgagcatccg
tcgctgccgctcgcgcaactgatcggtgcgccgatcctgatcgaatggcaggcgcaggaa
gggcgcgacgcgcgccggccgttccacggccacgtgatcgccgccgagctcgtcggctac
aacggcggactcgcacgcgtgcggctcgtcgtcgagccgtggctcacgctgttgcggcag
cgcgtcgacagctacaactatctggacgcgagcgtcgtcgagatcagcgaacaggtgttc
cgccgttacgcgcgcggcgtgatcgcgcccgcatggcgatgggcgctcgccgatgcggcg
aagtacccgaagcgcagcttgaccgcgcaagccggcgagtccgatttcgacttcctcgag
cggctctgggcggaggagggcatcttctactggttcgagcacgaaggcgacgcgcgcgcg
tcgagcctcggcaagcacacgctcgtgctcgccgattcgaatcagcgcttcgcgccggac
gaaccggagatcgtcggctttcatcagacgagcgacgacgacccgcaaggctgcatccag
cacttcatgcacgcgcggcgttggcgcatcggcagcgtcgcgcgcgcgagctgggatcac
cgcagcctgtcgacgcgtccgacgggcgcgcgcgcgaacggcgcggtcgcgccgggcgag
gatcgcgacgtcgcgggcccgtacgcataccagacgggcgcgatcggagaccggcgcgcg
cagcagcaactcgacgcccagcgcgtggccgcgctgcggagcgaaggccgcagcacgcgc
cgcgatctgcggcccgggctgcgttttgcgatcgcgcatcatccgacgctcggcgtatcg
gatgcgttcatctgcctgcgcgtcgagcattcggcgcgcgcgaacgtcgatgcgaccgtg
cgcagcgcgatcgaacagcgcctcggcgcgattgcgtcgatcgccggcgccgcgccggtg
ccgcatggccccgcgagcgcgctgaatgcggcgctcggcgccgatacgcatcacggcgga
tcgctgatgcgggacgacgccgtctatcgcaatcgcttcgtcgcgttgcccgccgagcag
acgtatcggccgctcgccgcatccggccatggcgcgcgcatgcacccggtcgccgtgatg
ccgggggcgcagacggcgatcgtcgtgggcgcgggcgatcccgttcacaccgaccgggat
caccggattcgaatccagcaccacgcgcagcgcggcgagaatgcggcgagccgcgacgat
cacccgcatgcggcgaacgcgccggcgaaccgtggcgcgggcacgtggacgcggatgatg
acgcccgtgggcggcgataactggggtggggtgagcgtgccgcgcgtcgggcaggaagtg
tggaccgaatggctcgaaggccagcccgaccggccggttgcggtggccgcgctctacaac
ggccgcggcaacgcgcacgcgcagcacaacgcgcaggcgggagggccgagcggcagcacc
ggcaatgcggccgcatggttcgccggcaatgcgcatgcggcggtgctgacgggtttcaag
acgcaggacatgagcatgagccagcaaggcacgggcggctatcggcaattcatgctcgac
gatacggcgggccagtcgagcgcgcgcctgtacacgacggaccgcaacagcgggctcacg
ctcgggcacgtgaagcagacgcaggacaaccggcgccaggccgatcgcggctatggcgcg
gaactggcgacggatgccgccggcgcgctgcgcggcggcgcggggctcttgatcagcacg
gcgcccggcgtgagccagatggatgcgagcgcgccgagccaggtgctcgctcagcatcga
cagacgttgcaaagcctcgcggcgctcgcgcacaagcagggcgcggagccgggcggtgcg
gtgcccgaggcggcgggcggagcgggcgcggcgtcggcgtcgacgggggcggcggcggac
aagcctttgccggccgtcgatggcatcgagcagagccgtgaagcgatcggcgcgacgcgt
gaaggaagcggcggcgatacggcaggcggcgggggcggcggcgcgattgcgtggagcaag
ccgcatctcgtcgcacacggcgaggcggggctggccgcgatgtcggcgaagagccacgtg
tgggtgtcgggtaccgagacggtgttgagcgccggacaggacgtgcaattgacggcgaag
ggcaagacgagcgtcgtcgcgaatcacggcatctcgctgtatacgcagggcgcggcgggc
gacgggcggccggttgccggccggggcatcgcgttgcacgcggcgtccggcgcggtgagt
gtgcaagcgcagaacgccggcaagctgagcgcgagcgcgcagaaggcggtgacgctcgcg
agcgcgcaaggcagcgcgtccgtgcaggcgcagcagcgcgtcctgctgagcgcggcgaag
gcctatctgaagatggaaggcaacgacatcgtcgtcggcgcgccggggcgcgcggatttc
aaggcggcggcgcatcagttgacggggccgaagagcgcgggggcgtcagcgcaaatgccg
aagagcgaaccgaagctgtgcgagtacaagacgcgcgcggccgacgttgctcacgaaggc
acgatgaagtcggcggcttga

DBGET integrated database retrieval system